The store will not work correctly when cookies are disabled.
SLC10A1
| Description | Sodium/bile acid cotransporter |
|---|
Gene and Protein Information
| Gene ID | 6554 |
|---|
| Uniprot Accession IDs | B9EGB6 Q2TU29 |
|---|
| Ensembl ID | ENSP00000216540 |
|---|
| Symbol | NTCP NTCP |
|---|
| Family | Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family. |
|---|
| Sequence | MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 453001 | SLC10A1 | solute carrier family 10 member 1 | 9598 | VGNC:8206 | OMA, EggNOG |
| Macaque | 712925 | SLC10A1 | solute carrier family 10 member 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 20493 | Slc10a1 | solute carrier family 10 (sodium/bile acid cotransporter family), member 1 | 10090 | MGI:97379 | Inparanoid, OMA, EggNOG |
| Rat | 24777 | Slc10a1 | solute carrier family 10 member 1 | 10116 | RGD:3681 | Inparanoid, OMA, EggNOG |
| Dog | 480372 | SLC10A1 | solute carrier family 10 member 1 | 9615 | VGNC:46211 | Inparanoid, OMA, EggNOG |
| Horse | 100064290 | SLC10A1 | solute carrier family 10 member 1 | 9796 | VGNC:23011 | Inparanoid, OMA, EggNOG |
| Cow | 532890 | SLC10A1 | solute carrier family 10 member 1 | 9913 | VGNC:34659 | Inparanoid, OMA, EggNOG |
| Pig | 100153302 | SLC10A1 | solute carrier family 10 member 1 | 9823 | | OMA, EggNOG |
| Opossum | 100028851 | SLC10A1 | solute carrier family 10 member 1 | 13616 | | Inparanoid, EggNOG |
| Anole lizard | | SLC10A1 | solute carrier family 10 member 1 [Source:HGNC Symbol;Acc:HGNC:10905] | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | | SLC10A1 | solute carrier family 10 member 1 [Source:HGNC Symbol;Acc:HGNC:10905] | 8364 | | OMA, EggNOG |
| Zebrafish | 562260 | slc10a1 | solute carrier family 10 (sodium/bile acid cotransporter), member 1 | 7955 | ZDB-GENE-041001-190 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
