Protein or Target Summary

Sodium/bile acid cotransporter

Gene ID	6554
uniprot	Q14973
Gene Name	SLC10A1
Ensernbl ID	ENSP00000216540
Family	Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family.
Sequence	MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	6554	SLC10A1	Sodium/bile acid cotransporter	Q14973
MOUSE		Slc10a1	Sodium/bile acid cotransporter	A0A1W2P719
MOUSE	20493	Slc10a1	Na/taurocholate cotransporting polypeptide 2	O35940
MOUSE	20493	Slc10a1	Sodium/bile acid cotransporter	O08705
RAT	24777	Slc10a1	Sodium/bile acid cotransporter	P26435

Protein Classes

PANTHER Classes
protein / transporter / cation transporter / Sodium/bile acid cotransporter

DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC10 family of sodium-bile acid co-transporters / Sodium/bile acid cotransporter

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx