NTSR2

DescriptionNeurotensin receptor type 2

Gene and Protein Information

Gene ID23620
Uniprot Accession IDs Q53QQ5 Q57Z87 Q8IY58 Q8TBH6 NT-R-2
Ensembl ID ENSP00000303686
Symbol NTR2
FamilyBelongs to the G-protein coupled receptor 1 family. Neurotensin receptor subfamily. NTSR2 sub-subfamily.
Sequence
METSSPRPPRPSSNPGLSLDARLGVDTRLWAKVLFTALYALIWALGAAGNALSAHVVLKARAGRAGRLRHHVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAYATVLSVAGLSAERCLAVCQPLRARSLLTPRRTRWLVALSWAASLGLALPMAVIMGQKHELETADGEPEPASRVCTVLVSRTALQVFIQVNVLVSFVLPLALTAFLNGVTVSHLLALCSQVPSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVSLVRHKDVRRIRSLQRSVQVLRAIVVMYVICWLPYHARRLMYCYVPDDAWTDPLYNFYHYFYMVTNTLFYVSSAVTPLLYNAVSSSFRKLFLEAVSSLCGEHHPMKRLPPKPQSPTLMDTASGFGDPPETRT
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp745294NTSR2neurotensin receptor 29598VGNC:328OMA, EggNOG
Macaque697563NTSR2neurotensin receptor 29544Inparanoid, OMA, EggNOG
Mouse18217Ntsr2neurotensin receptor 210090MGI:108018Inparanoid, OMA
Rat64636Ntsr2neurotensin receptor 210116RGD:70962Inparanoid, OMA
Dog482972NTSR2neurotensin receptor 29615VGNC:44015Inparanoid, OMA
Cow539336NTSR2neurotensin receptor 29913VGNC:32313Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Neurotensin receptor type 2
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Neurotensin receptor    /    Neurotensin receptor type 2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source