JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform

Gene ID	5530
uniprot	Q08209
Gene Name	PPP3CA
Ensernbl ID	ENSP00000378323
Family	Belongs to the PPP phosphatase family. PP-2B subfamily.
Sequence	MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	5530	PPP3CA	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform	Q08209
MOUSE		Ppp3ca	Ppp3ca protein	Q4V9X0
MOUSE		Ppp3ca	Uncharacterized protein	Q8C649
MOUSE	19055	Ppp3ca	Serine/threonine-protein phosphatase	B2RRX2
MOUSE	19055	Ppp3ca	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform	P63328
RAT	24674	Ppp3ca	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform	P63329

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx