JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Putative uncharacterized protein C8orf49

Gene ID	606553
uniprot	Q96NF6
Gene Name	C8orf49
Ensernbl ID
Sequence	MEKPRLYQKYKISRVWWRLPVIPATREAEDNRLNPEGRGCGEPRSRHCTPAWTTTAKLHLKTIISLQPLNMYQMEPGVGSIRTSPALQSPPALTRGPSAWDTAIRKALSFGVGLGVLVLVCLFYHFVTLAPILQFASLPCLLEAGAQMSRHPVTTQVCIMPARLSLGSGISRNLLRLSVCHFTLLLPFRSLRPCPLSSRDMVLSYELWLLCDFYIAPPDSSGSGICKKAI Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	606553	C8orf49	Putative uncharacterized protein C8orf49	Q96NF6

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx