Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

NEU4

DescriptionSialidase-4

Gene and Protein Information

Gene ID129807
Uniprot Accession IDs A8K056 J3KNJ5 Q96D64
Ensembl ID ENSP00000320318
FamilyBelongs to the glycosyl hydrolase 33 family.
Sequence
MGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPDDSHAHRLVLRRGTLAGGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQLPSGRLLVPAYTYRVDRRECFGKICRTSPHSFAFYSDDHGRTWRCGGLVPNLRSGECQLAAVDGGQAGSFLYCNARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPAPNRPRDDSWSVGPGSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQPRGDGPRQPGPRPGVSGDVGSWTLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTEPWVIYEGPSGYSDLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPRGCCWPS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque702264NEU4neuraminidase 49544Inparanoid, OMA, EggNOG
Mouse241159Neu4sialidase 410090MGI:2661364Inparanoid, OMA, EggNOG
Rat316642Neu4neuraminidase 410116RGD:1308624Inparanoid, OMA, EggNOG
Cow528030NEU4neuraminidase 49913VGNC:50074Inparanoid, OMA
Opossum103106800NEU4neuraminidase 413616Inparanoid, OMA
Anole lizard100560635neu4neuraminidase 428377Inparanoid, OMA
Zebrafish553569neu4sialidase 47955ZDB-GENE-050522-125Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    Sialidase-4
DTO Classes
protein    /    Enzyme    /    Hydrolase    /    Sialidase-4

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      The page will load shortly, Thanks for your patience!
      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      1.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      2.Comelli, Elena M EM, Amado, Margarida M, Lustig, Sarah R SR and Paulson, James C JC. 2003-12-04 Identification and expression of Neu4, a novel murine sialidase. [PMID:14637003]
      3.Ota, Toshio T and 156 more authors. 2004-01 Complete sequencing and characterization of 21,243 full-length human cDNAs. [PMID:14702039]
      4.Monti, E E and 12 more authors. 2004-03 Molecular cloning and characterization of NEU4, the fourth member of the human sialidase gene family. [PMID:14962670]
      5.Seyrantepe, Volkan V and 5 more authors. 2004-08-27 Neu4, a novel human lysosomal lumen sialidase, confers normal phenotype to sialidosis and galactosialidosis cells. [PMID:15213228]
      6.Gerhard, Daniela S DS and 115 more authors. 2004-10 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). [PMID:15489334]
      7.Wan, Dafang D and 24 more authors. 2004-11-02 Large-scale cDNA transfection screening for genes related to cancer development and progression. [PMID:15498874]
      8.Hillier, Ladeana W LW and 121 more authors. 2005-04-07 Generation and annotation of the DNA sequences of human chromosomes 2 and 4. [PMID:15815621]
      9.Stamatos, Nicholas M NM and 6 more authors. 2005-05 Differential expression of endogenous sialidases of human monocytes during cellular differentiation into macrophages. [PMID:15885103]
      10.Rual, Jean-François JF and 37 more authors. 2005-10-20 Towards a proteome-scale map of the human protein-protein interaction network. [PMID:16189514]