The store will not work correctly when cookies are disabled.
NEU4
Gene and Protein Information
| Gene ID | 129807 |
|---|
| Uniprot Accession IDs | A8K056 J3KNJ5 Q96D64 |
|---|
| Ensembl ID | ENSP00000320318 |
|---|
| Family | Belongs to the glycosyl hydrolase 33 family. |
|---|
| Sequence | MGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPDDSHAHRLVLRRGTLAGGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQLPSGRLLVPAYTYRVDRRECFGKICRTSPHSFAFYSDDHGRTWRCGGLVPNLRSGECQLAAVDGGQAGSFLYCNARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPAPNRPRDDSWSVGPGSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQPRGDGPRQPGPRPGVSGDVGSWTLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTEPWVIYEGPSGYSDLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPRGCCWPS Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 702264 | NEU4 | neuraminidase 4 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 241159 | Neu4 | sialidase 4 | 10090 | MGI:2661364 | Inparanoid, OMA, EggNOG |
| Rat | 316642 | Neu4 | neuraminidase 4 | 10116 | RGD:1308624 | Inparanoid, OMA, EggNOG |
| Cow | 528030 | NEU4 | neuraminidase 4 | 9913 | VGNC:50074 | Inparanoid, OMA |
| Opossum | 103106800 | NEU4 | neuraminidase 4 | 13616 | | Inparanoid, OMA |
| Anole lizard | 100560635 | neu4 | neuraminidase 4 | 28377 | | Inparanoid, OMA |
| Zebrafish | 553569 | neu4 | sialidase 4 | 7955 | ZDB-GENE-050522-125 | Inparanoid, OMA |
Protein Classes
PANTHER Classes protein /
hydrolase / Sialidase-4
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
