The store will not work correctly when cookies are disabled.
NPS
Description | Neuropeptide S |
---|
Gene and Protein Information
Gene ID | 594857 |
Uniprot Accession IDs | P0C0P6 |
Ensembl ID | ENSP00000381105 |
Sequence | MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKPILEKMFVKRSFRNGVGTGMKKTSFQRAKS |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 739817 | NPS | neuropeptide S | 9598 | VGNC:4967 | OMA, EggNOG |
Mouse | 100043254 | Nps | neuropeptide S | 10090 | MGI:3642232 | Inparanoid, OMA, EggNOG |
Rat | 100360071 | Nps | neuropeptide S | 10116 | RGD:2324597 | Inparanoid, OMA, EggNOG |
Dog | 111092983 | NPS | neuropeptide S | 9615 | VGNC:53003 | Inparanoid, OMA, EggNOG |
Pig | 106506150 | NPS | neuropeptide S | 9823 | | OMA, EggNOG |
Opossum | 100020780 | NPS | neuropeptide S | 13616 | | Inparanoid, EggNOG |
Anole lizard | | NPS | neuropeptide S [Source:HGNC Symbol;Acc:HGNC:33940] | 28377 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|