The store will not work correctly when cookies are disabled.
PPIA
| Description | Peptidyl-prolyl cis-trans isomerase A |
|---|
Gene and Protein Information
| Gene ID | 5478 |
|---|
| Uniprot Accession IDs | A8K220 P05092 Q3KQW3 Q567Q0 Q6IBU5 Q96IX3 Q9BRU4 Q9BTY9 Q9UC61 PPIase A |
|---|
| Ensembl ID | ENSP00000419425 |
|---|
| Symbol | CYPA CYPA CYPH HEL-S-69p |
|---|
| Family | Belongs to the cyclophilin-type PPIase family. PPIase A subfamily. |
|---|
| Sequence | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 574102 | PPIA | peptidylprolyl isomerase A | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 268373 | Ppia | peptidylprolyl isomerase A | 10090 | MGI:97749 | Inparanoid, OMA, EggNOG |
| Rat | 25518 | Ppia | peptidylprolyl isomerase A | 10116 | RGD:3372 | Inparanoid, OMA |
| Dog | 403581 | LOC403581 | peptidylprolyl isomerase A (cyclophilin A) pseudogene | 9615 | | OMA, EggNOG |
| Cow | 281418 | PPIA | peptidylprolyl isomerase A | 9913 | | Inparanoid, OMA, EggNOG |
| Pig | 397637 | PPIA | peptidylprolyl isomerase A | 9823 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
