Click Here for 5% Off Your First Aladdin Purchase!
Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

Protein or Target Summary

Peptidyl-prolyl cis-trans isomerase A

Gene ID5478
uniprotP62937
Gene NamePPIA
Ensernbl IDENSP00000419425
FamilyBelongs to the cyclophilin-type PPIase family. PPIase A subfamily.
Sequence
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN5478PPIAPeptidyl-prolyl cis-trans isomerase AP62937
MOUSEPpiaPeptidyl-prolyl cis-trans isomeraseA0A1L1SST0
MOUSEPpiaPeptidyl-prolyl cis-trans isomeraseQ3UAJ1
MOUSEPpiaPeptidyl-prolyl cis-trans isomeraseQ3TE63
MOUSEPpiaPeptidyl-prolyl cis-trans isomerase AA0A1L1SRX5
MOUSE268373PpiaPeptidyl-prolyl cis-trans isomeraseQ5SVY2
MOUSEPpiaPeptidyl-prolyl cis-trans isomeraseQ9CZK9
MOUSE268373PpiaPeptidyl-prolyl cis-trans isomerase AP17742
RATPpiaPeptidyl-prolyl cis-trans isomeraseA0A0G2K1P0
RAT25518PpiaPeptidyl-prolyl cis-trans isomerase AP10111

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      Source: DataSourcesLicenses.xlsx
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.