Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

PPIA

DescriptionPeptidyl-prolyl cis-trans isomerase A

Gene and Protein Information

Gene ID5478
Uniprot Accession IDs P62937 A8K220 P05092 Q3KQW3 Q567Q0 Q6IBU5 Q96IX3 Q9BRU4 Q9BTY9 Q9UC61 PPIase A
Ensembl ID ENSP00000419425
Symbol CYPA CYPA CYPH HEL-S-69p
FamilyBelongs to the cyclophilin-type PPIase family. PPIase A subfamily.
Sequence
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque574102PPIApeptidylprolyl isomerase A9544Inparanoid, OMA, EggNOG
Mouse268373Ppiapeptidylprolyl isomerase A10090MGI:97749Inparanoid, OMA, EggNOG
Rat25518Ppiapeptidylprolyl isomerase A10116RGD:3372Inparanoid, OMA
Dog403581LOC403581peptidylprolyl isomerase A (cyclophilin A) pseudogene9615OMA, EggNOG
Cow281418PPIApeptidylprolyl isomerase A9913Inparanoid, OMA, EggNOG
Pig397637PPIApeptidylprolyl isomerase A9823Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      Bibliography

      1.Endrich, M M MM, Gehrig, P P and Gehring, H H. 1999-02-26 Maturation-induced conformational changes of HIV-1 capsid protein and identification of two high affinity sites for cyclophilins in the C-terminal domain. [PMID:10026140]
      2.Bristow, R R and 7 more authors. 1999-04-01 Human cyclophilin has a significantly higher affinity for HIV-1 recombinant p55 than p24. [PMID:10096576]
      3.Grättinger, M M and 5 more authors. 1999-04-25 In vitro assembly properties of wild-type and cyclophilin-binding defective human immunodeficiency virus capsid proteins in the presence and absence of cyclophilin A. [PMID:10208938]
      4.Wiegers, K K, Rutter, G G, Schubert, U U, Grättinger, M M and Kräusslich, H G HG. 1999-04-25 Cyclophilin A incorporation is not required for human immunodeficiency virus type 1 particle maturation and does not destabilize the mature capsid. [PMID:10208939]
      5.Fitzon, T T and 6 more authors. 2000-03-15 Proline residues in the HIV-1 NH2-terminal capsid domain: structure determinants for proper core assembly and subsequent steps of early replication. [PMID:10704338]
      6.Li, Q Q and 6 more authors. 2000-05-04 Design of a Gag pentapeptide analogue that binds human cyclophilin A more efficiently than the entire capsid protein: new insights for the development of novel anti-HIV-1 drugs. [PMID:10794694]
      7. and Ivery, M T MT. 2000-11 Immunophilins: switched on protein binding domains? [PMID:11058892]
      8.Braaten, D D and Luban, J J. 2001-03-15 Cyclophilin A regulates HIV-1 infectivity, as demonstrated by gene targeting in human T cells. [PMID:11250896]
      9.Dietrich, L L, Ehrlich, L S LS, LaGrassa, T J TJ, Ebbets-Reed, D D and Carter, C C. 2001-05 Structural consequences of cyclophilin A binding on maturational refolding in human immunodeficiency virus type 1 capsid protein. [PMID:11312344]
      10.Suzuki, Y Y and 14 more authors. 2001-05 Identification and characterization of the potential promoter regions of 1031 kinds of human genes. [PMID:11337467]