SERPINI1

DescriptionNeuroserpin

Gene and Protein Information

Gene ID5274
Uniprot Accession IDs A8K217 D3DNP1 Q6AHZ4
Ensembl ID ENSP00000295777
Symbol PI12 PI12 neuroserpin
FamilyBelongs to the serpin family.
Sequence
MAFLGLFSLLVLQSMATGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp460834SERPINI1serpin family I member 19598VGNC:10044OMA, EggNOG
Macaque699483SERPINI1serpin family I member 19544Inparanoid, OMA, EggNOG
Mouse20713Serpini1serine (or cysteine) peptidase inhibitor, clade I, member 110090MGI:1194506Inparanoid, OMA, EggNOG
Rat116459Serpini1serpin family I member 110116RGD:619896Inparanoid, OMA, EggNOG
Dog478684SERPINI1serpin family I member 19615VGNC:46042Inparanoid, OMA, EggNOG
Horse100057410SERPINI1serpin family I member 19796VGNC:22863Inparanoid, OMA, EggNOG
Cow509976SERPINI1serpin family I member 19913VGNC:34481Inparanoid, OMA, EggNOG
Pig100154352SERPINI1serpin family I member 19823OMA, EggNOG
Opossum100010617SERPINI1serpin family I member 113616Inparanoid, OMA, EggNOG
Platypus100073875SERPINI1serpin family I member 19258Inparanoid, OMA, EggNOG
Chicken425002SERPINI1serpin family I member 19031CGNC:7200Inparanoid, OMA, EggNOG
Anole lizard100552314serpini1serpin family I member 128377Inparanoid, OMA, EggNOG
Xenopus100144746serpini1serpin family I member 18364XB-GENE-948443Inparanoid, OMA, EggNOG
Zebrafish557627serpini1serpin peptidase inhibitor, clade I (neuroserpin), member 17955ZDB-GENE-060503-390Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    serine protease inhibitor    /    Neuroserpin
DTO Classes
protein    /    Enzyme modulator    /    Protease inhibitor    /    Serine protease inhibitor    /    Neuroserpin

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Bibliography

      1.Davis, R L RL and 19 more authors. 1999-09-23 Familial dementia caused by polymerization of mutant neuroserpin. [PMID:10517635]
      2.Chang, W S WS, Chang, N T NT, Lin, S C SC, Wu, C W CW and Wu, F Y FY. 2000-11 Tissue-specific cancer-related serpin gene cluster at human chromosome band 3q26. [PMID:10992299]
      3.Davis, Richard L RL and 19 more authors. 2002-06-29 Association between conformational mutations in neuroserpin and onset and severity of dementia. [PMID:12103288]
      4.Barker-Carlson, Karen K, Lawrence, Daniel A DA and Schwartz, Bradford S BS. 2002-12-06 Acyl-enzyme complexes between tissue-type plasminogen activator and neuroserpin are short-lived in vitro. [PMID:12228252]
      5.Parmar, Parmjeet K PK, Coates, Leigh C LC, Pearson, John F JF, Hill, Rena M RM and Birch, Nigel P NP. 2002-09 Neuroserpin regulates neurite outgrowth in nerve growth factor-treated PC12 cells. [PMID:12354288]
      6.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      7.Yepes, Manuel M and Lawrence, Daniel A DA. 2004-03 Neuroserpin: a selective inhibitor of tissue-type plasminogen activator in the central nervous system. [PMID:14983220]
      8.Miranda, Elena E, Römisch, Karin K and Lomas, David A DA. 2004-07-02 Mutants of neuroserpin that cause dementia accumulate as polymers within the endoplasmic reticulum. [PMID:15090543]
      9.Teesalu, Tambet T and 6 more authors. 2004-08 Tissue plasminogen activator and neuroserpin are widely expressed in the human central nervous system. [PMID:15269833]
      10.Belorgey, Didier D and 5 more authors. 2004-08 Neuroserpin Portland (Ser52Arg) is trapped as an inactive intermediate that rapidly forms polymers: implications for the epilepsy seen in the dementia FENIB. [PMID:15291813]