The store will not work correctly when cookies are disabled.
SERPINI1
Gene and Protein Information
Gene ID | 5274 |
Uniprot Accession IDs | A8K217 D3DNP1 Q6AHZ4 |
Ensembl ID | ENSP00000295777 |
Symbol | PI12 PI12 neuroserpin |
Family | Belongs to the serpin family. |
Sequence | MAFLGLFSLLVLQSMATGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 460834 | SERPINI1 | serpin family I member 1 | 9598 | VGNC:10044 | OMA, EggNOG |
Macaque | 699483 | SERPINI1 | serpin family I member 1 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 20713 | Serpini1 | serine (or cysteine) peptidase inhibitor, clade I, member 1 | 10090 | MGI:1194506 | Inparanoid, OMA, EggNOG |
Rat | 116459 | Serpini1 | serpin family I member 1 | 10116 | RGD:619896 | Inparanoid, OMA, EggNOG |
Dog | 478684 | SERPINI1 | serpin family I member 1 | 9615 | VGNC:46042 | Inparanoid, OMA, EggNOG |
Horse | 100057410 | SERPINI1 | serpin family I member 1 | 9796 | VGNC:22863 | Inparanoid, OMA, EggNOG |
Cow | 509976 | SERPINI1 | serpin family I member 1 | 9913 | VGNC:34481 | Inparanoid, OMA, EggNOG |
Pig | 100154352 | SERPINI1 | serpin family I member 1 | 9823 | | OMA, EggNOG |
Opossum | 100010617 | SERPINI1 | serpin family I member 1 | 13616 | | Inparanoid, OMA, EggNOG |
Platypus | 100073875 | SERPINI1 | serpin family I member 1 | 9258 | | Inparanoid, OMA, EggNOG |
Chicken | 425002 | SERPINI1 | serpin family I member 1 | 9031 | CGNC:7200 | Inparanoid, OMA, EggNOG |
Anole lizard | 100552314 | serpini1 | serpin family I member 1 | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | 100144746 | serpini1 | serpin family I member 1 | 8364 | XB-GENE-948443 | Inparanoid, OMA, EggNOG |
Zebrafish | 557627 | serpini1 | serpin peptidase inhibitor, clade I (neuroserpin), member 1 | 7955 | ZDB-GENE-060503-390 | Inparanoid, OMA |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|