The store will not work correctly when cookies are disabled.
NPY4R
| Description | Neuropeptide Y receptor type 4 |
|---|
Gene and Protein Information
| Gene ID | 100996758 |
|---|
| Uniprot Accession IDs | Q13456 Q5ISU3 Q5T2X9 Q6FH06 NPY4-R |
|---|
| Ensembl ID | ENSP00000363431 |
|---|
| Symbol | PPYR1 PP1 NPY4R PPYR1 NPY4-R CH17-360D5.1 |
|---|
| Family | Belongs to the G-protein coupled receptor 1 family. |
|---|
| Sequence | MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNLCLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLTAVYTIMDYWIFGETLCKMSAFIQCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVLIWVIACVLSLPFLANSILENVFHKNHSKALEFLADKVVCTESWPLAHHRTIYTTFLLLFQYCLPLGFILVCYARIYRRLQRQGRVFHKGTYSLRAGHMKQVNVVLVVMVVAFAVLWLPLHVFNSLEDWHHEAIPICHGNLIFLVCHLLAMASTCVNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTEVSKGSLRLSGRSNPI Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Mouse | 19065 | Npy4r | neuropeptide Y receptor Y4 | 10090 | MGI:105374 | Inparanoid, OMA |
| Rat | 29471 | Npy4r | neuropeptide Y receptor Y4 | 10116 | RGD:61864 | Inparanoid, OMA |
| Cow | 505889 | PPYR1 | pancreatic polypeptide receptor 1 | 9913 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
