Protein or Target Summary
Diphosphoinositol polyphosphate phosphohydrolase 2
| Gene ID | 11163 |
|---|---|
| uniprot | Q9NZJ9 |
| Gene Name | NUDT4 |
| Ensernbl ID | ENSP00000338352 |
| Family | Belongs to the Nudix hydrolase family. DIPP subfamily. |
| Sequence | MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 11163 | NUDT4 | Diphosphoinositol polyphosphate phosphohydrolase 2 | Q9NZJ9 |
| MOUSE | 71207 | Nudt4 | Nudix (Nucleoside diphosphate linked moiety X)-type motif 4, isoform CRA_b | Q4FJR0 |
| MOUSE | 71207 | Nudt4 | Diphosphoinositol polyphosphate phosphohydrolase 2 | Q8R2U6 |
| RAT | 94267 | Nudt4 | Diphosphoinositol polyphosphate phosphohydrolase 2 | Q99MY2 |
Protein Classes
PANTHER Classes
protein / hydrolase / Diphosphoinositol polyphosphate phosphohydrolase 2
protein / phosphatase / Diphosphoinositol polyphosphate phosphohydrolase 2
protein / hydrolase / Diphosphoinositol polyphosphate phosphohydrolase 2
protein / phosphatase / Diphosphoinositol polyphosphate phosphohydrolase 2
DTO Classes
protein / Enzyme / Hydrolase / Phosphatase / Diphosphoinositol polyphosphate phosphohydrolase 2
protein / Enzyme / Hydrolase / Phosphatase / Diphosphoinositol polyphosphate phosphohydrolase 2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx