Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

NPY1R

DescriptionNeuropeptide Y receptor type 1

Gene and Protein Information

Gene ID4886
Uniprot Accession IDs B2R6H5 NPY1-R
Ensembl ID ENSP00000354652
Symbol NPYR NPYY1 NPYR NPY1-R
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp471331NPY1Rneuropeptide Y receptor Y19598VGNC:648OMA, EggNOG
Macaque574206NPY1Rneuropeptide Y receptor Y19544Inparanoid, OMA, EggNOG
Mouse18166Npy1rneuropeptide Y receptor Y110090MGI:104963Inparanoid, OMA, EggNOG
Rat29358Npy1rneuropeptide Y receptor Y110116RGD:3198Inparanoid, OMA, EggNOG
Dog399518NPY1Rneuropeptide Y receptor Y19615VGNC:43937Inparanoid, OMA, EggNOG
Horse100061686NPY1Rneuropeptide Y receptor Y19796VGNC:20853Inparanoid, OMA, EggNOG
Cow504813NPY1Rneuropeptide Y receptor Y19913VGNC:32223Inparanoid, OMA, EggNOG
Pig397547NPY1Rneuropeptide Y receptor Y19823Inparanoid, OMA, EggNOG
Opossum100022417NPY1Rneuropeptide Y receptor Y113616Inparanoid, OMA, EggNOG
Chicken428727NPY1Rneuropeptide Y receptor Y19031CGNC:53446Inparanoid, OMA
Anole lizard100561643npy1rneuropeptide Y receptor Y128377Inparanoid, OMA
Zebrafish793668npy1rneuropeptide Y receptor Y17955ZDB-GENE-080221-1Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Neuropeptide Y receptor    /    Neuropeptide y receptor type 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.