The store will not work correctly when cookies are disabled.
Protein or Target Summary
10 kDa heat shock protein, mitochondrial
| Gene ID | 3336 |
|---|
| uniprot | P61604 |
|---|
| Gene Name | HSPE1 |
|---|
| Ensernbl ID | ENSP00000233893 |
|---|
| Family | Belongs to the GroES chaperonin family. |
|---|
| Sequence | MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 3336 | HSPE1 | 10 kDa heat shock protein, mitochondrial | P61604 |
| MOUSE | 15528 | Hspe1 | 10 kDa heat shock protein, mitochondrial | Q64433 |
| MOUSE | 15528 | Hspe1 | Heat shock protein 1 (Chaperonin 10) | Q4KL76 |
| RAT | | Hspe1 | 10 kDa heat shock protein, mitochondrial | P26772 |
| RAT | 25462 | Hspe1 | Chaperonin 10 | P97601 |
| RAT | | Hspe1 | 10 kDa heat shock protein, mitochondrial | A0A0G2JTG1 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
