The store will not work correctly when cookies are disabled.
Protein or Target Summary
ATP-sensitive inward rectifier potassium channel 10
| Gene ID | 3766 |
|---|
| uniprot | P78508 |
|---|
| Gene Name | KCNJ10 |
|---|
| Ensernbl ID | ENSP00000357068 |
|---|
| Family | Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ10 subfamily. |
|---|
| Sequence | MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 3766 | KCNJ10 | ATP-sensitive inward rectifier potassium channel 10 | P78508 |
| MOUSE | 16513 | Kcnj10 | Uncharacterized protein | Q8C7Z5 |
| MOUSE | | Kcnj10 | Kcnj10 protein | Q499F6 |
| MOUSE | 16513 | Kcnj10 | Inward rectifying potassium channel Kir4.1 | Q56VN0 |
| MOUSE | | Kcnj10 | Kcnj10 protein | B9EIV1 |
| MOUSE | 16513 | Kcnj10 | ATP-sensitive inward rectifier potassium channel 10 | Q9JM63 |
| RAT | | Kcnj10 | ATP-sensitive inward rectifier potassium channel 10 | A0A0H2UHF5 |
| RAT | 29718 | Kcnj10 | ATP-sensitive inward rectifier potassium channel 10 | P49655 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
