The store will not work correctly when cookies are disabled.
KCNJ10
| Description | ATP-sensitive inward rectifier potassium channel 10 |
|---|
Gene and Protein Information
| Gene ID | 3766 |
|---|
| Uniprot Accession IDs | A3KME7 Q5VUT9 Q8N4I7 Q92808 |
|---|
| Ensembl ID | ENSP00000357068 |
|---|
| Symbol | KIR1.2 KIR4.1 SESAME BIRK-10 KCNJ13-PEN |
|---|
| Family | Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ10 subfamily. |
|---|
| Sequence | MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Mouse | 16513 | Kcnj10 | potassium inwardly-rectifying channel, subfamily J, member 10 | 10090 | MGI:1194504 | Inparanoid, OMA, EggNOG |
| Rat | 29718 | Kcnj10 | potassium voltage-gated channel subfamily J member 10 | 10116 | RGD:61822 | Inparanoid, OMA |
| Horse | 100058121 | KCNJ10 | potassium voltage-gated channel subfamily J member 10 | 9796 | VGNC:19284 | Inparanoid, OMA, EggNOG |
| Cow | 533343 | KCNJ10 | potassium voltage-gated channel subfamily J member 10 | 9913 | VGNC:30454 | Inparanoid, OMA, EggNOG |
| Opossum | 100023256 | KCNJ10 | potassium voltage-gated channel subfamily J member 10 | 13616 | | Inparanoid, OMA, EggNOG |
| Xenopus | 779765 | kcnj10 | potassium channel, inwardly rectifying subfamily J, member 10 | 8364 | XB-GENE-5777345 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
