The store will not work correctly when cookies are disabled.
IL10
| Description | Interleukin-10 |
|---|
Gene and Protein Information
| Gene ID | 3586 |
|---|
| Uniprot Accession IDs | IL-10 |
|---|
| Ensembl ID | ENSP00000412237 |
|---|
| Symbol | CSIF TGIF GVHDS IL-10 IL10A |
|---|
| Family | Belongs to the IL-10 family. |
|---|
| Sequence | MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 469657 | IL10 | interleukin 10 | 9598 | VGNC:52981 | Inparanoid, OMA, EggNOG |
| Macaque | 694931 | IL10 | interleukin 10 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 16153 | Il10 | interleukin 10 | 10090 | MGI:96537 | Inparanoid, OMA, EggNOG |
| Rat | 25325 | Il10 | interleukin 10 | 10116 | RGD:2886 | Inparanoid, OMA, EggNOG |
| Dog | 403628 | IL10 | interleukin 10 | 9615 | VGNC:41928 | Inparanoid, OMA, EggNOG |
| Horse | 100034187 | IL10 | interleukin 10 | 9796 | VGNC:50843 | Inparanoid, OMA, EggNOG |
| Cow | 281246 | IL10 | interleukin 10 | 9913 | | Inparanoid, OMA, EggNOG |
| Pig | 397106 | IL10 | interleukin 10 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100616748 | IL10 | interleukin 10 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100077352 | IL10 | interleukin 10 | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 428264 | IL10 | interleukin 10 | 9031 | CGNC:588 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100563091 | il10 | interleukin 10 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100335053 | il10 | interleukin 10 | 8364 | XB-GENE-479918 | Inparanoid, OMA, EggNOG |
| Zebrafish | 553957 | il10 | interleukin 10 | 7955 | ZDB-GENE-051111-1 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
