The store will not work correctly when cookies are disabled.
Protein or Target Summary
Interleukin-21 receptor
| Gene ID | 50615 |
|---|
| uniprot | Q9HBE5 |
|---|
| Gene Name | IL21R |
|---|
| Ensernbl ID | ENSP00000338010 |
|---|
| Family | Belongs to the type I cytokine receptor family. Type 4 subfamily. |
|---|
| Sequence | MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLLLLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSSLELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGSPLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 50615 | IL21R | Interleukin-21 receptor | Q9HBE5 |
| MOUSE | | Il21r | Uncharacterized protein | Q3UBS8 |
| MOUSE | | Il21r | Interleukin-21 receptor | A0A0U1RP02 |
| MOUSE | | Il21r | Uncharacterized protein | Q3TA82 |
| MOUSE | | Il21r | Il21r protein | Q6PEU8 |
| MOUSE | 60504 | Il21r | Interleukin 21 receptor, isoform CRA_c | Q3TAI3 |
| MOUSE | 60504 | Il21r | Interleukin-21 receptor | Q9JHX3 |
| RAT | 308977 | Il21r | Interleukin 21 receptor | Q5EBB1 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
