The store will not work correctly when cookies are disabled.
IL3
Gene and Protein Information
| Gene ID | 3562 |
|---|
| Uniprot Accession IDs | Q6GS87 IL-3 |
|---|
| Ensembl ID | ENSP00000296870 |
|---|
| Symbol | IL-3 MCGF MULTI-CSF |
|---|
| Family | Belongs to the IL-3 family. |
|---|
| Sequence | MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 471626 | IL3 | interleukin 3 | 9598 | VGNC:4044 | Inparanoid, OMA, EggNOG |
| Macaque | 706946 | IL3 | interleukin 3 | 9544 | | Inparanoid, OMA, EggNOG |
| Dog | 481497 | IL3 | interleukin 3 | 9615 | VGNC:53502 | Inparanoid, OMA |
| Cow | 280823 | IL3 | interleukin 3 (colony-stimulating factor, multiple) | 9913 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
