Protein or Target Summary
Homeobox protein Meis1
Gene ID | 4211 |
---|---|
uniprot | O00470 |
Gene Name | MEIS1 |
Ensernbl ID | ENSP00000272369 |
Family | Belongs to the TALE/MEIS homeobox family. |
Sequence | MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM Show more |
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|---|---|---|---|
HUMAN | 4211 | MEIS1 | Homeobox protein Meis1 | O00470 |
MOUSE | Meis1 | Homeobox protein Meis1 | A0A0A0MQB8 | |
MOUSE | Meis1 | Homeobox protein Meis1 | H3BLB6 | |
MOUSE | Meis1 | Uncharacterized protein | Q3UJ00 | |
MOUSE | Meis1 | Homeobox protein Meis1 | V9GXB5 | |
MOUSE | 17268 | Meis1 | Homeobox protein Meis1 | Q60954 |
RAT | 686117 | Meis1 | Meis homeobox 1 | B1WC31 |
Protein Classes
PANTHER Classes
protein / RNA binding protein / homeodomain transcription factor / Homeobox protein Meis1
protein / RNA binding protein / DNA-directed RNA polymerase / Homeobox protein Meis1
protein / RNA binding protein / homeodomain transcription factor / Homeobox protein Meis1
protein / RNA binding protein / DNA-directed RNA polymerase / Homeobox protein Meis1
DTO Classes
protein / Enzyme / Transferase / Nucleotidyltransferase / Polymerase / DNA-directed RNA polymerase / Homeobox protein Meis1
protein / Enzyme / Transferase / Nucleotidyltransferase / Polymerase / DNA-directed RNA polymerase / Homeobox protein Meis1
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx