The store will not work correctly when cookies are disabled.
Protein or Target Summary
Interferon-induced transmembrane protein 2
| Gene ID | 10581 |
|---|
| uniprot | Q01629 |
|---|
| Gene Name | IFITM2 |
|---|
| Ensernbl ID | ENSP00000484689 |
|---|
| Family | Belongs to the CD225/Dispanin family. |
|---|
| Sequence | MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWSLFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGIFMTILLIIIPVLVVQAQR Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 10581 | IFITM2 | Interferon-induced transmembrane protein 2 | Q01629 |
| MOUSE | 80876 | Ifitm2 | Interferon-induced transmembrane protein 2 | Q99J93 |
| RAT | 114709 | Ifitm2 | Interferon-induced transmembrane protein 2 | Q9R175 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
