The store will not work correctly when cookies are disabled.
ISG15
Description | Ubiquitin-like protein ISG15 |
---|
Gene and Protein Information
Gene ID | 9636 |
Uniprot Accession IDs | Q5SVA4 Q7Z2G2 Q96GF0 |
Ensembl ID | ENSP00000368699 |
Symbol | G1P2 UCRP G1P2 IP17 UCRP IFI15 IMD38 hUCRP |
Sequence | MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 100609237 | LOC100609237 | ubiquitin-like protein ISG15 | 9598 | | OMA, EggNOG |
Macaque | 700141 | ISG15 | ISG15 ubiquitin-like modifier | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 100038882 | Isg15 | ISG15 ubiquitin-like modifier | 10090 | MGI:1855694 | Inparanoid, OMA, EggNOG |
Rat | 298693 | Isg15 | ISG15 ubiquitin-like modifier | 10116 | RGD:1310312 | Inparanoid, OMA, EggNOG |
Dog | 100855667 | ISG15 | ISG15 ubiquitin-like modifier | 9615 | VGNC:42106 | Inparanoid, OMA, EggNOG |
Horse | 100066364 | ISG15 | ISG15 ubiquitin-like modifier | 9796 | | Inparanoid, OMA, EggNOG |
Cow | 281871 | ISG15 | ISG15 ubiquitin-like modifier | 9913 | VGNC:30293 | Inparanoid, OMA, EggNOG |
Anole lizard | 103280520 | isg15 | ISG15 ubiquitin-like modifier | 28377 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|