Protein or Target Summary
Ubiquitin-like protein ISG15
| Gene ID | 9636 |
|---|---|
| uniprot | P05161 |
| Gene Name | ISG15 |
| Ensernbl ID | ENSP00000368699 |
| Sequence | MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS Show more |
Gene and Protein Information
Protein Classes
DTO Classes
protein / Nucleic acid binding / RNA binding protein / Ribosomal protein / Ubiquitin-like protein ISG15
protein / Nucleic acid binding / RNA binding protein / Ribosomal protein / Ubiquitin-like protein ISG15
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: TCRDv6_DataSourcesLicenses.xlsx