The store will not work correctly when cookies are disabled.
CTHRC1
| Description | Collagen triple helix repeat-containing protein 1 |
|---|
Gene and Protein Information
| Gene ID | 115908 |
|---|
| Uniprot Accession IDs | G3V141 Q6UW91 Q8IX63 |
|---|
| Ensembl ID | ENSP00000330523 |
|---|
| Sequence | MRPQGPAASPQRLRGLLLLLLLQLPAPSSASEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 472834 | CTHRC1 | collagen triple helix repeat containing 1 | 9598 | VGNC:11962 | OMA, EggNOG |
| Macaque | 694882 | CTHRC1 | collagen triple helix repeat containing 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 68588 | Cthrc1 | collagen triple helix repeat containing 1 | 10090 | MGI:1915838 | Inparanoid, OMA, EggNOG |
| Rat | 282836 | Cthrc1 | collagen triple helix repeat containing 1 | 10116 | RGD:628801 | Inparanoid, OMA, EggNOG |
| Dog | 100684449 | CTHRC1 | collagen triple helix repeat containing 1 | 9615 | VGNC:49728 | Inparanoid, OMA, EggNOG |
| Horse | 100062543 | CTHRC1 | collagen triple helix repeat containing 1 | 9796 | VGNC:16936 | Inparanoid, OMA, EggNOG |
| Cow | 538634 | CTHRC1 | collagen triple helix repeat containing 1 | 9913 | VGNC:27796 | Inparanoid, OMA, EggNOG |
| Pig | 100152510 | CTHRC1 | collagen triple helix repeat containing 1 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100031016 | CTHRC1 | collagen triple helix repeat containing 1 | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 420262 | CTHRC1 | collagen triple helix repeat containing 1 | 9031 | CGNC:12007 | Inparanoid, OMA |
| Anole lizard | 100565432 | cthrc1 | collagen triple helix repeat containing 1 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 548356 | cthrc1 | collagen triple helix repeat containing 1 | 8364 | XB-GENE-980161 | OMA, EggNOG |
| Zebrafish | 566140 | cthrc1b | collagen triple helix repeat containing 1b | 7955 | ZDB-GENE-050420-46 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
