Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

PRKACA

DescriptioncAMP-dependent protein kinase catalytic subunit alpha

Gene and Protein Information

Gene ID5566
Uniprot Accession IDs Q32P54 Q9H2Y0 Q9NRB4 Q9NRH9 PKA C-alpha
Ensembl ID ENSP00000309591
Symbol PKACA PKACA PPNAD4
FamilyBelongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily.
Sequence
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp107966260PRKACAprotein kinase cAMP-activated catalytic subunit alpha9598VGNC:12065OMA, EggNOG
Mouse18747Prkacaprotein kinase, cAMP dependent, catalytic, alpha10090MGI:97592Inparanoid, OMA, EggNOG
Rat25636Prkacaprotein kinase cAMP-activated catalytic subunit alpha10116RGD:3389Inparanoid, OMA, EggNOG
Dog403556PRKACAprotein kinase cAMP-activated catalytic subunit alpha9615Inparanoid, OMA
Horse100064302PRKACAprotein kinase cAMP-activated catalytic subunit alpha9796VGNC:49525Inparanoid, OMA
Cow282322PRKACAprotein kinase cAMP-activated catalytic subunit alpha9913VGNC:50250Inparanoid, OMA
Pig397652PRKACAprotein kinase cAMP-activated catalytic subunit alpha9823Inparanoid, OMA
Zebrafish564064prkacaaprotein kinase, cAMP-dependent, catalytic, alpha, genome duplicate a7955ZDB-GENE-050114-6Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Kinase    /    Protein kinase    /    AGC group    /    PKA family    /    Camp-dependent protein kinase catalytic subunit alpha

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Bibliography

      1.Endo, S S and 7 more authors. 1999-03-02 Molecular identification of human G-substrate, a possible downstream component of the cGMP-dependent protein kinase cascade in cerebellar Purkinje cells. [PMID:10051666]
      2.Schneider, A A, Biernat, J J, von Bergen, M M, Mandelkow, E E and Mandelkow, E M EM. 1999-03-23 Phosphorylation that detaches tau protein from microtubules (Ser262, Ser214) also protects it against aggregation into Alzheimer paired helical filaments. [PMID:10090741]
      3.Laxminarayana, D D and 5 more authors. 1999-05-01 Diminished levels of protein kinase A RI alpha and RI beta transcripts and proteins in systemic lupus erythematosus T lymphocytes. [PMID:10228048]
      4.Carvalho, A L AL, Kameyama, K K and Huganir, R L RL. 1999-06-15 Characterization of phosphorylation sites on the glutamate receptor 4 subunit of the AMPA receptors. [PMID:10366608]
      5.Hayashi, Y Y and 6 more authors. 1999-07-16 Regulation of neuronal nitric-oxide synthase by calmodulin kinases. [PMID:10400690]
      6.Wang, J J and Brown, E J EJ. 1999-08-20 Immune complex-induced integrin activation and L-plastin phosphorylation require protein kinase A. [PMID:10446213]
      7.Kitamura, T T and 10 more authors. 1999-09 Insulin-induced phosphorylation and activation of cyclic nucleotide phosphodiesterase 3B by the serine-threonine kinase Akt. [PMID:10454575]
      8.Saxena, M M, Williams, S S, Taskén, K K and Mustelin, T T. 1999-09 Crosstalk between cAMP-dependent kinase and MAP kinase through a protein tyrosine phosphatase. [PMID:10559944]
      9.Hosaka, M M, Hammer, R E RE and Südhof, T C TC. 1999-10 A phospho-switch controls the dynamic association of synapsins with synaptic vesicles. [PMID:10571231]
      10.Zimmermann, S S and Moelling, K K. 1999-11-26 Phosphorylation and regulation of Raf by Akt (protein kinase B). [PMID:10576742]