The store will not work correctly when cookies are disabled.
IL6
Gene and Protein Information
| Gene ID | 3569 |
|---|
| Uniprot Accession IDs | Q9UCU2 Q9UCU3 Q9UCU4 IL-6 |
|---|
| Ensembl ID | ENSP00000385675 |
|---|
| Symbol | IFNB2 CDF HGF HSF BSF2 IL-6 BSF-2 IFNB2 IFN-beta-2 |
|---|
| Family | Belongs to the IL-6 superfamily. |
|---|
| Sequence | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 463288 | IL6 | interleukin 6 | 9598 | VGNC:4400 | OMA, EggNOG |
| Macaque | 705819 | IL6 | interleukin 6 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 16193 | Il6 | interleukin 6 | 10090 | MGI:96559 | Inparanoid, OMA, EggNOG |
| Rat | 24498 | Il6 | interleukin 6 | 10116 | RGD:2901 | Inparanoid, OMA, EggNOG |
| Dog | 403985 | IL6 | interleukin 6 | 9615 | VGNC:41992 | Inparanoid, OMA, EggNOG |
| Horse | 100034196 | IL6 | interleukin 6 | 9796 | VGNC:52396 | Inparanoid, OMA, EggNOG |
| Cow | 280826 | IL6 | interleukin 6 | 9913 | VGNC:30166 | Inparanoid, OMA, EggNOG |
| Pig | 399500 | IL6 | interleukin 6 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 103104339 | IL6 | interleukin 6 | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 395337 | IL6 | interleukin 6 | 9031 | CGNC:8294 | Inparanoid, OMA, EggNOG |
| Xenopus | 100493927 | il6 | interleukin 6 | 8364 | XB-GENE-480186 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
