MAPK1
| Description | Mitogen-activated protein kinase 1 |
|---|
Gene and Protein Information
| Gene ID | 5594 |
|---|---|
| Uniprot Accession IDs | A8CZ64 MAP kinase 1 |
| Ensembl ID | ENSP00000215832 |
| Symbol | ERK2 PRKM1 PRKM2 ERK p38 p40 p41 ERK2 ERT1 ERK-2 MAPK2 PRKM1 PRKM2 P42MAPK p41mapk p42-MAPK |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily. |
| Sequence | MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 458680 | MAPK1 | mitogen-activated protein kinase 1 | 9598 | VGNC:12896 | OMA, EggNOG |
| Macaque | 698569 | MAPK1 | mitogen-activated protein kinase 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 26413 | Mapk1 | mitogen-activated protein kinase 1 | 10090 | MGI:1346858 | Inparanoid, OMA |
| Rat | 116590 | Mapk1 | mitogen activated protein kinase 1 | 10116 | RGD:70500 | Inparanoid, OMA, EggNOG |
| Dog | 477575 | MAPK1 | mitogen-activated protein kinase 1 | 9615 | VGNC:42991 | Inparanoid, OMA, EggNOG |
| Horse | 100057701 | MAPK1 | mitogen-activated protein kinase 1 | 9796 | VGNC:19954 | Inparanoid, OMA, EggNOG |
| Cow | 327672 | MAPK1 | mitogen-activated protein kinase 1 | 9913 | VGNC:31212 | Inparanoid, OMA, EggNOG |
| Pig | 100153927 | MAPK1 | mitogen-activated protein kinase 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100028096 | MAPK1 | mitogen-activated protein kinase 1 | 13616 | OMA, EggNOG | |
| Chicken | 373953 | MAPK1 | mitogen-activated protein kinase 1 | 9031 | CGNC:48975 | Inparanoid, OMA |
| Anole lizard | 100555877 | mapk1 | mitogen-activated protein kinase 1 | 28377 | Inparanoid, OMA | |
| Xenopus | 549881 | mapk1 | mitogen-activated protein kinase 1 | 8364 | XB-GENE-479467 | Inparanoid, OMA |
| Zebrafish | 360144 | mapk1 | mitogen-activated protein kinase 1 | 7955 | ZDB-GENE-030722-2 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Mitogen-activated protein kinase 1
protein / protein kinase / Mitogen-activated protein kinase 1
protein / transferase / Mitogen-activated protein kinase 1
protein / kinase / Mitogen-activated protein kinase 1
protein / non-receptor serine/threonine protein kinase / Mitogen-activated protein kinase 1
protein / protein kinase / Mitogen-activated protein kinase 1
protein / transferase / Mitogen-activated protein kinase 1
protein / kinase / Mitogen-activated protein kinase 1
DTO Classes
protein / Kinase / Protein kinase / CMGC group / MAPK family / ERK subfamily / Mitogen-activated protein kinase 1
protein / Kinase / Protein kinase / CMGC group / MAPK family / ERK subfamily / Mitogen-activated protein kinase 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|