Protein or Target Summary
Mitogen-activated protein kinase 1
| Gene ID | 5594 |
|---|---|
| uniprot | P28482 |
| Gene Name | MAPK1 |
| Ensernbl ID | ENSP00000215832 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily. |
| Sequence | MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 5594 | MAPK1 | Mitogen-activated protein kinase 1 | P28482 |
| MOUSE | Mapk1 | Mitogen-activated protein kinase 1 | A0A338P781 | |
| MOUSE | Mapk1 | Mitogen-activated protein kinase | Q3UF82 | |
| MOUSE | Mapk1 | Mitogen-activated protein kinase 1 | A0A338P736 | |
| MOUSE | Mapk1 | Mapk1 protein | Q922X7 | |
| MOUSE | 26413 | Mapk1 | Mitogen-activated protein kinase 1 | P63085 |
| RAT | 116590 | Mapk1 | Mitogen-activated protein kinase 1 | P63086 |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Mitogen-activated protein kinase 1
protein / protein kinase / Mitogen-activated protein kinase 1
protein / transferase / Mitogen-activated protein kinase 1
protein / kinase / Mitogen-activated protein kinase 1
protein / non-receptor serine/threonine protein kinase / Mitogen-activated protein kinase 1
protein / protein kinase / Mitogen-activated protein kinase 1
protein / transferase / Mitogen-activated protein kinase 1
protein / kinase / Mitogen-activated protein kinase 1
DTO Classes
protein / Kinase / Protein kinase / CMGC group / MAPK family / ERK subfamily / Mitogen-activated protein kinase 1
protein / Kinase / Protein kinase / CMGC group / MAPK family / ERK subfamily / Mitogen-activated protein kinase 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx