MAPK11

DescriptionMitogen-activated protein kinase 11

Gene and Protein Information

Gene ID5600
Uniprot Accession IDs A8K730 B0LPG1 B7Z630 E7ETQ1 L7RT27 O00284 O15472 Q2XNF2 MAP kinase 11
Ensembl ID ENSP00000333685
Symbol PRKM11 SAPK2 SAPK2B P38B SAPK2 p38-2 PRKM11 SAPK2B p38Beta P38BETA2
FamilyBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
Sequence
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque715794MAPK11mitogen-activated protein kinase 119544Inparanoid, OMA
Mouse19094Mapk11mitogen-activated protein kinase 1110090MGI:1338024Inparanoid, OMA
Rat689314Mapk11mitogen-activated protein kinase 1110116RGD:1309340Inparanoid, OMA
Horse100056278MAPK11mitogen-activated protein kinase 119796VGNC:19956Inparanoid, OMA
Cow618906MAPK11mitogen-activated protein kinase 119913VGNC:31214Inparanoid, OMA
Anole lizard100563731mapk11mitogen-activated protein kinase 1128377Inparanoid, OMA
Zebrafish415185mapk11mitogen-activated protein kinase 117955ZDB-GENE-040625-75Inparanoid, OMA
C. elegans191743pmk-1Mitogen-activated protein kinase pmk-16239Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    non-receptor serine/threonine protein kinase    /    Mitogen-activated protein kinase 11
protein    /    protein kinase    /    Mitogen-activated protein kinase 11
protein    /    transferase    /    Mitogen-activated protein kinase 11
protein    /    kinase    /    Mitogen-activated protein kinase 11
DTO Classes
protein    /    Kinase    /    Protein kinase    /    CMGC group    /    MAPK family    /    P38 subfamily    /    Mitogen-activated protein kinase 11

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source