| Description | Mitogen-activated protein kinase 11 |
|---|
Gene and Protein Information
| Gene ID | 5600 |
|---|---|
| Uniprot Accession IDs | A8K730 B0LPG1 B7Z630 E7ETQ1 L7RT27 O00284 O15472 Q2XNF2 MAP kinase 11 |
| Ensembl ID | ENSP00000333685 |
| Symbol | PRKM11 SAPK2 SAPK2B P38B SAPK2 p38-2 PRKM11 SAPK2B p38Beta P38BETA2 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily. |
| Sequence | MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 715794 | MAPK11 | mitogen-activated protein kinase 11 | 9544 | Inparanoid, OMA | |
| Mouse | 19094 | Mapk11 | mitogen-activated protein kinase 11 | 10090 | MGI:1338024 | Inparanoid, OMA |
| Rat | 689314 | Mapk11 | mitogen-activated protein kinase 11 | 10116 | RGD:1309340 | Inparanoid, OMA |
| Horse | 100056278 | MAPK11 | mitogen-activated protein kinase 11 | 9796 | VGNC:19956 | Inparanoid, OMA |
| Cow | 618906 | MAPK11 | mitogen-activated protein kinase 11 | 9913 | VGNC:31214 | Inparanoid, OMA |
| Anole lizard | 100563731 | mapk11 | mitogen-activated protein kinase 11 | 28377 | Inparanoid, OMA | |
| Zebrafish | 415185 | mapk11 | mitogen-activated protein kinase 11 | 7955 | ZDB-GENE-040625-75 | Inparanoid, OMA |
| C. elegans | 191743 | pmk-1 | Mitogen-activated protein kinase pmk-1 | 6239 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Mitogen-activated protein kinase 11
protein / protein kinase / Mitogen-activated protein kinase 11
protein / transferase / Mitogen-activated protein kinase 11
protein / kinase / Mitogen-activated protein kinase 11
protein / non-receptor serine/threonine protein kinase / Mitogen-activated protein kinase 11
protein / protein kinase / Mitogen-activated protein kinase 11
protein / transferase / Mitogen-activated protein kinase 11
protein / kinase / Mitogen-activated protein kinase 11
DTO Classes
protein / Kinase / Protein kinase / CMGC group / MAPK family / P38 subfamily / Mitogen-activated protein kinase 11
protein / Kinase / Protein kinase / CMGC group / MAPK family / P38 subfamily / Mitogen-activated protein kinase 11
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|