The store will not work correctly when cookies are disabled.
Protein or Target Summary
Mitogen-activated protein kinase 11
| Target ID | 19482 |
|---|
| Gene ID | 5600 |
|---|
| uniprot | Q15759 |
|---|
| Gene Name | MAPK11 |
|---|
| Ensernbl ID | ENSP00000333685 |
|---|
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily. |
|---|
| Sequence | MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 5600 | MAPK11 | Mitogen-activated protein kinase 11 | Q15759 |
| MOUSE | | Mapk11 | Mitogen-activated protein kinase | Q3TT60 |
| MOUSE | | Mapk11 | Mitogen-activated protein kinase | Q6PG57 |
| MOUSE | | Mapk11 | Mitogen-activated protein kinase | Q6P243 |
| MOUSE | 19094 | Mapk11 | Mitogen-activated protein kinase 11 | Q9WUI1 |
| RAT | 689314 | Mapk11 | Mitogen-activated protein kinase | D4A3U7 |
| RAT | 689314 | Mapk11 | Mitogen-activated protein kinase | A0A0G2KB06 |
Protein Classes
protein / Kinase / Protein kinase / CMGC group / MAPK family / P38 subfamily / Mitogen-activated protein kinase 11
Pathway
| Data Source | Name | Explore in Pharos | Explore in Source |
|---|
