MAPK13
| Description | Mitogen-activated protein kinase 13 |
|---|
Gene and Protein Information
| Gene ID | 5603 |
|---|---|
| Uniprot Accession IDs | O14739 O15124 Q5U4A5 Q6FI46 Q9UNU0 MAP kinase 13 |
| Ensembl ID | ENSP00000211287 |
| Symbol | PRKM13 SAPK4 SAPK4 PRKM13 MAPK 13 MAPK-13 p38delta |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily. |
| Sequence | MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 462644 | MAPK13 | mitogen-activated protein kinase 13 | 9598 | VGNC:7195 | Inparanoid, OMA, EggNOG |
| Macaque | 719085 | MAPK13 | mitogen-activated protein kinase 13 | 9544 | OMA, EggNOG | |
| Mouse | 26415 | Mapk13 | mitogen-activated protein kinase 13 | 10090 | MGI:1346864 | Inparanoid, OMA, EggNOG |
| Rat | 29513 | Mapk13 | mitogen activated protein kinase 13 | 10116 | RGD:3045 | Inparanoid, OMA, EggNOG |
| Dog | 612821 | MAPK13 | mitogen-activated protein kinase 13 | 9615 | VGNC:42994 | Inparanoid, OMA |
| Cow | 535327 | MAPK13 | mitogen-activated protein kinase 13 | 9913 | VGNC:50213 | Inparanoid, OMA |
| Opossum | 100028821 | MAPK13 | mitogen-activated protein kinase 13 | 13616 | Inparanoid, OMA | |
| Anole lizard | 100567479 | mapk13 | mitogen-activated protein kinase 13 | 28377 | Inparanoid, OMA | |
| Xenopus | 100144715 | mapk13 | mitogen-activated protein kinase 13 | 8364 | XB-GENE-490713 | Inparanoid, OMA |
| Zebrafish | 100002318 | mapk13 | mitogen-activated protein kinase 13 | 7955 | ZDB-GENE-041111-17 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Mitogen-activated protein kinase 13
protein / protein kinase / Mitogen-activated protein kinase 13
protein / transferase / Mitogen-activated protein kinase 13
protein / kinase / Mitogen-activated protein kinase 13
protein / non-receptor serine/threonine protein kinase / Mitogen-activated protein kinase 13
protein / protein kinase / Mitogen-activated protein kinase 13
protein / transferase / Mitogen-activated protein kinase 13
protein / kinase / Mitogen-activated protein kinase 13
DTO Classes
protein / Kinase / Protein kinase / CMGC group / MAPK family / P38 subfamily / Mitogen-activated protein kinase 13
protein / Kinase / Protein kinase / CMGC group / MAPK family / P38 subfamily / Mitogen-activated protein kinase 13
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|