Protein or Target Summary
Mitogen-activated protein kinase 13
| Gene ID | 5603 |
|---|---|
| uniprot | O15264 |
| Gene Name | MAPK13 |
| Ensernbl ID | ENSP00000211287 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily. |
| Sequence | MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 5603 | MAPK13 | Mitogen-activated protein kinase 13 | O15264 |
| MOUSE | Mapk13 | Mitogen-activated protein kinase 13 | A0A3B2WAS4 | |
| MOUSE | Mapk13 | Mitogen-activated protein kinase 13 | A0A3B2W3M0 | |
| MOUSE | Mapk13 | Mitogen-activated protein kinase 13 | A0A3B2WDA4 | |
| MOUSE | Mapk13 | Mitogen-activated protein kinase 13 | A0A3B2WBD8 | |
| MOUSE | Mapk13 | Mitogen-activated protein kinase | D6RG58 | |
| MOUSE | Mapk13 | Mitogen-activated protein kinase 13 | A0A3B2WBB9 | |
| MOUSE | 26415 | Mapk13 | Mitogen-activated protein kinase | Q3UIB2 |
| MOUSE | 26415 | Mapk13 | Mitogen-activated protein kinase 13 | Q9Z1B7 |
| RAT | 29513 | Mapk13 | Mitogen-activated protein kinase | Q32Q45 |
| RAT | Mapk13 | Mitogen-activated protein kinase | G3V618 | |
| RAT | Mapk13 | Mitogen-activated protein kinase 13 | Q9WTY9 |
Protein Classes
PANTHER Classes
protein / non-receptor serine/threonine protein kinase / Mitogen-activated protein kinase 13
protein / protein kinase / Mitogen-activated protein kinase 13
protein / transferase / Mitogen-activated protein kinase 13
protein / kinase / Mitogen-activated protein kinase 13
protein / non-receptor serine/threonine protein kinase / Mitogen-activated protein kinase 13
protein / protein kinase / Mitogen-activated protein kinase 13
protein / transferase / Mitogen-activated protein kinase 13
protein / kinase / Mitogen-activated protein kinase 13
DTO Classes
protein / Kinase / Protein kinase / CMGC group / MAPK family / P38 subfamily / Mitogen-activated protein kinase 13
protein / Kinase / Protein kinase / CMGC group / MAPK family / P38 subfamily / Mitogen-activated protein kinase 13
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx