The store will not work correctly when cookies are disabled.
LAT
Description | Linker for activation of T-cells family member 1 |
---|
Gene and Protein Information
Gene ID | 27040 |
Uniprot Accession IDs | B7WPI0 C7C5T6 G5E9K3 O43919 |
Ensembl ID | ENSP00000378845 |
Symbol | LAT1 pp36 IMD52 |
Sequence | MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 743295 | LAT | linker for activation of T-cells | 9598 | | OMA, EggNOG |
Mouse | 16797 | Lat | linker for activation of T cells | 10090 | MGI:1342293 | Inparanoid, OMA, EggNOG |
Rat | 81511 | Lat | linker for activation of T cells | 10116 | RGD:620802 | Inparanoid, OMA, EggNOG |
Dog | 607947 | LAT | linker for activation of T cells | 9615 | VGNC:42596 | Inparanoid, OMA, EggNOG |
Horse | 100064430 | LAT | linker for activation of T cells | 9796 | VGNC:19595 | Inparanoid, OMA, EggNOG |
Cow | 514735 | LAT | linker for activation of T cells | 9913 | VGNC:50054 | OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|