The store will not work correctly when cookies are disabled.
LAT
| Description | Linker for activation of T-cells family member 1 |
|---|
Gene and Protein Information
| Gene ID | 27040 |
|---|
| Uniprot Accession IDs | B7WPI0 C7C5T6 G5E9K3 O43919 |
|---|
| Ensembl ID | ENSP00000378845 |
|---|
| Symbol | LAT1 pp36 IMD52 |
|---|
| Sequence | MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 743295 | LAT | linker for activation of T-cells | 9598 | | OMA, EggNOG |
| Mouse | 16797 | Lat | linker for activation of T cells | 10090 | MGI:1342293 | Inparanoid, OMA, EggNOG |
| Rat | 81511 | Lat | linker for activation of T cells | 10116 | RGD:620802 | Inparanoid, OMA, EggNOG |
| Dog | 607947 | LAT | linker for activation of T cells | 9615 | VGNC:42596 | Inparanoid, OMA, EggNOG |
| Horse | 100064430 | LAT | linker for activation of T cells | 9796 | VGNC:19595 | Inparanoid, OMA, EggNOG |
| Cow | 514735 | LAT | linker for activation of T cells | 9913 | VGNC:50054 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
