Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

Gamma-crystallin C

Gene ID1420
uniprotP07315
Gene NameCRYGC
Ensernbl IDENSP00000282141
FamilyBelongs to the beta/gamma-crystallin family.
Sequence
MGKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPNYQGQQYLLRRGEYPDYQQWMGLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN1420CRYGCGamma-crystallin CP07315
MOUSE12966CrygcGamma-crystallin CQ61597
MOUSE12966CrygcCrystallin, gamma CA3RLD4
MOUSE12966CrygcGamma-crystallin CA3RLD5
RAT24277CrygcGamma-crystallin CP02529
RATCrygcGamma-crystallin CF1LQX2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source