The store will not work correctly when cookies are disabled.
CRYGC
| Description | Gamma-crystallin C |
|---|
Gene and Protein Information
| Gene ID | 1420 |
|---|
| Uniprot Accession IDs | Q53R50 |
|---|
| Ensembl ID | ENSP00000282141 |
|---|
| Symbol | CRYG3 CCL CRYG3 CTRCT2 |
|---|
| Family | Belongs to the beta/gamma-crystallin family. |
|---|
| Sequence | MGKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPNYQGQQYLLRRGEYPDYQQWMGLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 737363 | CRYGC | crystallin gamma C | 9598 | VGNC:151 | Inparanoid, OMA, EggNOG |
| Macaque | 709553 | CRYGC | crystallin, gamma C | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 12966 | Crygc | crystallin, gamma C | 10090 | MGI:88523 | Inparanoid, OMA, EggNOG |
| Rat | 24277 | Crygc | crystallin, gamma C | 10116 | RGD:2421 | Inparanoid, OMA |
| Dog | 100126770 | CRYGC | crystallin, gamma C | 9615 | | Inparanoid, OMA |
| Horse | 100069179 | LOC100069179 | gamma-crystallin C | 9796 | | Inparanoid, OMA |
| Cow | 281722 | CRYGC | crystallin gamma C | 9913 | VGNC:27741 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
