Protein or Target Summary
Protein cornichon homolog 3
| Gene ID | 149111 |
|---|---|
| uniprot | Q8TBE1 |
| Gene Name | CNIH3 |
| Ensernbl ID | ENSP00000272133 |
| Family | Belongs to the cornichon family. |
| Sequence | MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 149111 | CNIH3 | Protein cornichon homolog 3 | Q8TBE1 |
| MOUSE | 72978 | Cnih3 | Protein cornichon homolog 3 | Q6ZWS4 |
| MOUSE | Cnih3 | Protein cornichon homolog 3 | A0A1B0GSP1 | |
| MOUSE | 72978 | Cnih3 | Cornichon homolog 3 (Drosophila), isoform CRA_a | G3XA11 |
| MOUSE | 72978 | Cnih3 | Protein cornichon homolog 3 | Q9D6E1 |
| RAT | 690252 | Cnih3 | Protein cornichon homolog 3 | D0Q0Y7 |
Protein Classes
PANTHER Classes
protein / signaling molecule / membrane-bound signaling molecule / Protein cornichon homolog 3
protein / signaling molecule / membrane traffic protein / Protein cornichon homolog 3
protein / signaling molecule / membrane-bound signaling molecule / Protein cornichon homolog 3
protein / signaling molecule / membrane traffic protein / Protein cornichon homolog 3
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx