JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Protein N-lysine methyltransferase METTL21A

Gene ID	151194
uniprot	Q8WXB1
Gene Name	METTL21A
Ensernbl ID	ENSP00000415115
Family	Belongs to the methyltransferase superfamily. METTL21 family.
Sequence	MALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAIVLSTYLEMGAVELRGRSAVELGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVKELTWGQNLGSFSPGEFDLILGADIIYLEETFTDLLQTLEHLCSNHSVILLACRIRYERDNNFLAMLERQFTVRKVHYDPEKDVHIYEAQKRNQKEDL Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	151194	METTL21A	Protein N-lysine methyltransferase METTL21A	Q8WXB1
MOUSE	67099	Mettl21A	Protein N-lysine methyltransferase METTL21A	Q9CQL0
RAT	102553119	Mettl21a	Methyltransferase-like 21A	D4A8Z5

Protein Classes

DTO Classes
protein / Epigenetic regulator / Writer / Protein methyltransferase / Protein N-lysine methyltransferase METTL21A

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx