The store will not work correctly when cookies are disabled.
NR2E3
Description | Photoreceptor-specific nuclear receptor |
---|
Gene and Protein Information
Gene ID | 10002 |
Uniprot Accession IDs | B6ZGU0 Q9UHM4 |
Ensembl ID | ENSP00000482504 |
Symbol | PNR RNR PNR RNR rd7 ESCS RP37 |
Family | Belongs to the nuclear hormone receptor family. NR2 subfamily. |
Sequence | METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVCGDSSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Macaque | 701402 | NR2E3 | nuclear receptor subfamily 2 group E member 3 | 9544 | | Inparanoid, OMA |
Mouse | 23958 | Nr2e3 | nuclear receptor subfamily 2, group E, member 3 | 10090 | MGI:1346317 | Inparanoid, OMA |
Cow | 281944 | NR2E3 | nuclear receptor subfamily 2 group E member 3 | 9913 | VGNC:32239 | Inparanoid, OMA |
Chicken | 395289 | NR2E3 | nuclear receptor subfamily 2 group E member 3 | 9031 | CGNC:49244 | Inparanoid, OMA |
Xenopus | 100036597 | nr2e3 | nuclear receptor subfamily 2 group E member 3 | 8364 | XB-GENE-485801 | Inparanoid, OMA |
Zebrafish | 492496 | nr2e3 | nuclear receptor subfamily 2, group E, member 3 | 7955 | ZDB-GENE-041114-63 | Inparanoid, OMA |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|