The store will not work correctly when cookies are disabled.
POU2AF1
Description | POU domain class 2-associating factor 1 |
---|
Gene and Protein Information
Gene ID | 5450 |
Uniprot Accession IDs | B2R8Z9 Q14983 |
Ensembl ID | ENSP00000376786 |
Symbol | OBF1 BOB1 OBF1 OCAB OBF-1 |
Family | Belongs to the POU2AF1 family. |
Sequence | MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 451537 | POU2AF1 | POU class 2 associating factor 1 | 9598 | VGNC:1045 | OMA, EggNOG |
Macaque | 709752 | POU2AF1 | POU class 2 associating factor 1 | 9544 | | OMA, EggNOG |
Mouse | 18985 | Pou2af1 | POU domain, class 2, associating factor 1 | 10090 | MGI:105086 | Inparanoid, OMA, EggNOG |
Rat | 690528 | Pou2af1 | POU class 2 associating factor 1 | 10116 | RGD:1594728 | Inparanoid, OMA, EggNOG |
Dog | 489413 | POU2AF1 | POU class 2 associating factor 1 | 9615 | VGNC:44825 | Inparanoid, OMA, EggNOG |
Horse | 100070302 | POU2AF1 | POU class 2 associating factor 1 | 9796 | VGNC:21707 | Inparanoid, OMA, EggNOG |
Cow | 528475 | POU2AF1 | POU class 2 associating factor 1 | 9913 | VGNC:33173 | Inparanoid, OMA, EggNOG |
Pig | 100512063 | POU2AF1 | POU class 2 associating factor 1 | 9823 | | Inparanoid, OMA, EggNOG |
Opossum | 100032355 | POU2AF1 | POU class 2 associating factor 1 | 13616 | | Inparanoid, OMA, EggNOG |
Platypus | 100089514 | POU2AF1 | POU class 2 associating factor 1 | 9258 | | Inparanoid, EggNOG |
Anole lizard | 100553601 | pou2af1 | POU class 2 associating factor 1 | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | 100496996 | pou2af1 | POU class 2 associating factor 1 | 8364 | XB-GENE-854772 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|