Protein or Target Summary

Mitochondrial 2-oxodicarboxylate carrier

Gene ID	89874
uniprot	Q9BQT8
Gene Name	SLC25A21
Ensernbl ID	ENSP00000329452
Family	Belongs to the mitochondrial carrier (TC 2.A.29) family.
Sequence	MSAKPEVSLVREASRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATDPNSYKSLVDSFRMIFQMEGLFGFYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGLTEAIVVNPFEVVKVGLQANRNTFAEQPSTVGYARQIIKKEGWGLQGLNKGLTATLGRHGVFNMVYFGFYYNVKNMIPVNKDPILEFWRKFGIGLLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAVMLLVYEYTYSWLQENW Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	89874	SLC25A21	Mitochondrial 2-oxodicarboxylate carrier	Q9BQT8
MOUSE	217593	Slc25a21	Uncharacterized protein	Q3TRZ4
MOUSE	217593	Slc25a21	Mitochondrial 2-oxodicarboxylate carrier	B6CI26
MOUSE	217593	Slc25a21	Mitochondrial 2-oxodicarboxylate carrier	Q8BZ09
RAT		Slc25a21	Mitochondrial 2-oxodicarboxylate carrier	A0A140TAF1
RAT	171151	Slc25a21	Mitochondrial 2-oxodicarboxylate carrier	Q99JD3

Protein Classes

DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC25 family of mitochondrial transporters / Mitochondrial di- and tri-carboxylic acid transporter subfamily / Mitochondrial 2-oxodicarboxylate carrier

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx