SLC25A21

Description	Mitochondrial 2-oxodicarboxylate carrier

Gene and Protein Information

Gene ID	89874
Uniprot Accession IDs	A8K0L0 G3V4L5 Q3MJ99
Ensembl ID	ENSP00000329452
Symbol	ODC ODC ODC1
Family	Belongs to the mitochondrial carrier (TC 2.A.29) family.
Sequence	MSAKPEVSLVREASRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATDPNSYKSLVDSFRMIFQMEGLFGFYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGLTEAIVVNPFEVVKVGLQANRNTFAEQPSTVGYARQIIKKEGWGLQGLNKGLTATLGRHGVFNMVYFGFYYNVKNMIPVNKDPILEFWRKFGIGLLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAVMLLVYEYTYSWLQENW

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	467433	SLC25A21	solute carrier family 25 member 21	9598	VGNC:12533	OMA, EggNOG
Macaque	697370	SLC25A21	solute carrier family 25 member 21	9544		Inparanoid, OMA, EggNOG
Mouse	217593	Slc25a21	solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21	10090	MGI:2445059	Inparanoid, OMA, EggNOG
Rat	171151	Slc25a21	solute carrier family 25 member 21	10116	RGD:621444	Inparanoid, OMA, EggNOG
Dog	490655	SLC25A21	solute carrier family 25 member 21	9615	VGNC:46300	Inparanoid, OMA, EggNOG
Horse	100059414	SLC25A21	solute carrier family 25 member 21	9796	VGNC:23097	Inparanoid, OMA, EggNOG
Cow	513423	SLC25A21	solute carrier family 25 member 21	9913	VGNC:34749	Inparanoid, OMA, EggNOG
Pig	100156821	PAX9	paired box 9	9823		OMA, EggNOG
Opossum	100012583	SLC25A21	solute carrier family 25 member 21	13616		Inparanoid, EggNOG
Platypus		SLC25A21	solute carrier family 25 member 21 [Source:HGNC Symbol;Acc:HGNC:14411]	9258		OMA, EggNOG
Chicken	423330	SLC25A21	solute carrier family 25 member 21	9031	CGNC:7688	Inparanoid, OMA, EggNOG
Anole lizard	100557800	slc25a21	solute carrier family 25 member 21	28377		Inparanoid, OMA, EggNOG
Xenopus	549823	slc25a21	solute carrier family 25 (mitochondrial oxoadipate carrier), member 21	8364	XB-GENE-943812	Inparanoid, OMA, EggNOG
Zebrafish	767694	slc25a21	solute carrier family 25 (mitochondrial oxoadipate carrier), member 21	7955	ZDB-GENE-060929-664	Inparanoid, OMA, EggNOG
C. elegans	181692	slc-25A21	SLC (SoLute Carrier) homolog	6239		OMA, EggNOG
S.cerevisiae	855969	ODC1	mitochondrial 2-oxodicarboxylate carrier	4932	S000006055	Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC25 family of mitochondrial transporters / Mitochondrial di- and tri-carboxylic acid transporter subfamily / Mitochondrial 2-oxodicarboxylate carrier

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source