Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

MPC1

DescriptionMitochondrial pyruvate carrier 1

Gene and Protein Information

Gene ID51660
Uniprot Accession IDs B2R5I7 Q5TI66 Q9HB67 Q9UQN4
Ensembl ID ENSP00000354223
Symbol BRP44L MPYCD BRP44L CGI-129 SLC54A1
FamilyBelongs to the mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family.
Sequence
MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp737234MPC1mitochondrial pyruvate carrier 19598VGNC:3488OMA, EggNOG
Macaque716864MPC1mitochondrial pyruvate carrier 19544OMA, EggNOG
Mouse55951Mpc1mitochondrial pyruvate carrier 110090MGI:1915240Inparanoid, OMA, EggNOG
Rat171087Mpc1mitochondrial pyruvate carrier 110116RGD:620902Inparanoid, OMA, EggNOG
HorseMPC1mitochondrial pyruvate carrier 1 [Source:HGNC Symbol;Acc:HGNC:21606]9796OMA, EggNOG
Cow767977MPC1mitochondrial pyruvate carrier 19913VGNC:31569Inparanoid, OMA, EggNOG
OpossumMPC1mitochondrial pyruvate carrier 1 [Source:HGNC Symbol;Acc:HGNC:21606]13616Inparanoid, OMA, EggNOG
Platypus100074647MPC1mitochondrial pyruvate carrier 19258Inparanoid, OMA, EggNOG
Chicken428592MPC1mitochondrial pyruvate carrier 19031CGNC:8725OMA, EggNOG
Anole lizard100553357mpc1mitochondrial pyruvate carrier 128377Inparanoid, OMA, EggNOG
Xenopus448739mpc1mitochondrial pyruvate carrier 18364XB-GENE-970069OMA, EggNOG
Zebrafish436671mpc1mitochondrial pyruvate carrier 17955ZDB-GENE-040718-94Inparanoid, OMA, EggNOG
Fruitfly42268Mpc1Mitochondrial pyruvate carrier7227FBgn0038662Inparanoid, EggNOG
S.cerevisiae852800MPC1pyruvate transporter MPC14932S000003048OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC54 Mitochondrial pyruvate carriers    /    Mitochondrial pyruvate carrier 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.