Click Here for 5% Off Your First Aladdin Purchase!
Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

Protein or Target Summary

Mitochondrial pyruvate carrier 1

Gene ID51660
uniprotQ9Y5U8
Gene NameMPC1
Ensernbl IDENSP00000354223
FamilyBelongs to the mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family.
Sequence
MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN51660MPC1Mitochondrial pyruvate carrier 1Q9Y5U8
MOUSEMpc1Mitochondrial pyruvate carrierD3YWY6
MOUSEMpc1Mitochondrial pyruvate carrierQ9D6B6
MOUSEMpc1Mitochondrial pyruvate carrierD3Z786
MOUSEMpc1Mitochondrial pyruvate carrierE9Q0V4
MOUSEMpc1Mitochondrial pyruvate carrierQ3TCV4
MOUSE55951Mpc1Mitochondrial pyruvate carrierQ3UX28
MOUSE55951Mpc1Mitochondrial pyruvate carrierD3Z5S0
MOUSE55951Mpc1Mitochondrial pyruvate carrier 1P63030
RAT171087Mpc1Mitochondrial pyruvate carrier 1P63031

Protein Classes

DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC54 Mitochondrial pyruvate carriers    /    Mitochondrial pyruvate carrier 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      Source: DataSourcesLicenses.xlsx
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.