The store will not work correctly when cookies are disabled.
Protein or Target Summary
Protein mago nashi homolog
| Gene ID | 4116 |
|---|
| uniprot | P61326 |
|---|
| Gene Name | MAGOH |
|---|
| Ensernbl ID | ENSP00000360525 |
|---|
| Family | Belongs to the mago nashi family. |
|---|
| Sequence | MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 4116 | MAGOH | Protein mago nashi homolog | P61326 |
| MOUSE | 17149 | Magoh | Protein mago nashi homolog | P61327 |
| RAT | 298385 | Magoh | Protein mago nashi homolog | Q27W02 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
