The store will not work correctly when cookies are disabled.
Protein or Target Summary
Microsomal glutathione S-transferase 3
| Gene ID | 4259 |
|---|
| uniprot | O14880 |
|---|
| Gene Name | MGST3 |
|---|
| Ensernbl ID | ENSP00000356864 |
|---|
| Family | Belongs to the MAPEG family. |
|---|
| Sequence | MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 4259 | MGST3 | Microsomal glutathione S-transferase 3 | O14880 |
| MOUSE | | Mgst3 | Uncharacterized protein | Q9D8B0 |
| MOUSE | 66447 | Mgst3 | Microsomal glutathione S-transferase 3 | Q9CPU4 |
| RAT | 289197 | Mgst3 | Microsomal glutathione S-transferase 3 | D4ADS4 |
Protein Classes
PANTHER Classes protein /
transferase / Microsomal glutathione S-transferase 3
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
