The store will not work correctly when cookies are disabled.
CDC25C
Description | M-phase inducer phosphatase 3 |
---|
Gene and Protein Information
Gene ID | 995 |
Uniprot Accession IDs | D3DQB8 Q96PL3 Q9H168 Q9H2E8 Q9H2E9 Q9H2F1 |
Ensembl ID | ENSP00000321656 |
Symbol | CDC25 PPP1R60 |
Family | Belongs to the MPI phosphatase family. |
Sequence | MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 746151 | CDC25C | cell division cycle 25C | 9598 | VGNC:3940 | OMA, EggNOG |
Macaque | 714115 | CDC25C | cell division cycle 25C | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 12532 | Cdc25c | cell division cycle 25C | 10090 | MGI:88350 | Inparanoid, OMA, EggNOG |
Rat | 307511 | Cdc25c | cell division cycle 25C | 10116 | RGD:1311875 | Inparanoid, OMA |
Dog | 610456 | CDC25C | cell division cycle 25C | 9615 | VGNC:38991 | Inparanoid, OMA, EggNOG |
Horse | 100062352 | CDC25C | cell division cycle 25C | 9796 | VGNC:16292 | Inparanoid, OMA, EggNOG |
Cow | 507731 | CDC25C | cell division cycle 25C | 9913 | VGNC:27064 | Inparanoid, OMA, EggNOG |
Pig | 100144474 | CDC25C | cell division cycle 25C | 9823 | | Inparanoid, OMA, EggNOG |
Opossum | 100025023 | CDC25C | cell division cycle 25C | 13616 | | Inparanoid, EggNOG |
Anole lizard | 100565034 | cdc25c | cell division cycle 25C | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | 100124300 | cdc25c | cell division cycle 25C | 8364 | XB-GENE-944821 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|