The store will not work correctly when cookies are disabled.
P2RX1
| Description | P2X purinoceptor 1 |
|---|
Gene and Protein Information
| Gene ID | 5023 |
|---|
| Uniprot Accession IDs | Q9UK84 P2X1 |
|---|
| Ensembl ID | ENSP00000225538 |
|---|
| Symbol | P2X1 P2X1 |
|---|
| Family | Belongs to the P2X receptor family. |
|---|
| Sequence | MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSGLISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEHPEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENGTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKRHYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 454439 | P2RX1 | purinergic receptor P2X 1 | 9598 | VGNC:9500 | OMA, EggNOG |
| Macaque | 707658 | P2RX1 | purinergic receptor P2X 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 18436 | P2rx1 | purinergic receptor P2X, ligand-gated ion channel, 1 | 10090 | MGI:1098235 | Inparanoid, OMA, EggNOG |
| Rat | 25505 | P2rx1 | purinergic receptor P2X 1 | 10116 | RGD:3240 | Inparanoid, OMA, EggNOG |
| Dog | 491223 | P2RX1 | purinergic receptor P2X 1 | 9615 | VGNC:44207 | Inparanoid, OMA, EggNOG |
| Horse | 100060689 | P2RX1 | purinergic receptor P2X 1 | 9796 | VGNC:21106 | Inparanoid, OMA, EggNOG |
| Cow | 514898 | P2RX1 | purinergic receptor P2X 1 | 9913 | VGNC:32517 | OMA, EggNOG |
| Pig | 106504105 | P2RX1 | purinergic receptor P2X 1 | 9823 | | OMA, EggNOG |
| Xenopus | | P2RX1 | purinergic receptor P2X 1 [Source:HGNC Symbol;Acc:HGNC:8533] | 8364 | | OMA, EggNOG |
| Zebrafish | 387296 | p2rx1 | purinergic receptor P2X, ligand-gated ion channel, 1 | 7955 | ZDB-GENE-030319-1 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
