NPBWR2

Description	Neuropeptides B/W receptor type 2

Gene and Protein Information

Gene ID	2832
Uniprot Accession IDs	Q6NWQ6 Q9H4K3
Ensembl ID	ENSP00000358783
Symbol	GPR8 GPR8
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MQAAGHPEPLDSRGSFSLPTMGANVSQDNGTGHNATFSEPLPFLYVLLPAVYSGICAVGLTGNTAVILVILRAPKMKTVTNVFILNLAVADGLFTLVLPVNIAEHLLQYWPFGELLCKLVLAVDHYNIFSSIYFLAVMSVDRYLVVLATVRSRHMPWRTYRGAKVASLCVWLGVTVLVLPFFSFAGVYSNELQVPSCGLSFPWPEQVWFKASRVYTLVLGFVLPVCTICVLYTDLLRRLRAVRLRSGAKALGKARRKVTVLVLVVLAVCLLCWTPFHLASVVALTTDLPQTPLVISMSYVITSLSYANSCLNPFLYAFLDDNFRKNFRSILRC Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	719200	NPBWR2	neuropeptides B and W receptor 2	9544		Inparanoid, OMA, EggNOG
Horse	100051823	NPBWR2	neuropeptides B and W receptor 2	9796	VGNC:20830	Inparanoid, OMA
Anole lizard	100562082	npbwr2	neuropeptides B and W receptor 2	28377		Inparanoid, OMA

Protein Classes

PANTHER Classes
protein / receptor / G-protein coupled receptor / Neuropeptides b/w receptor type 2

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Neuropeptide W/neuropeptide B receptor / Neuropeptides b/w receptor type 2

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]