Protein or Target Summary
HLA class II histocompatibility antigen, DP beta 1 chain
Gene ID | 3115 |
---|---|
uniprot | P04440 |
Gene Name | HLA-DPB1 |
Ensernbl ID | ENSP00000408146 |
Family | Belongs to the MHC class II family. |
Sequence | MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA Show more |
Gene and Protein Information
Protein Classes
PANTHER Classes
protein / defense/immunity protein / major histocompatibility complex antigen / HLA class II histocompatibility antigen, DP beta 1 chain
protein / defense/immunity protein / major histocompatibility complex antigen / HLA class II histocompatibility antigen, DP beta 1 chain
DTO Classes
protein / Immune response / Major histocompatibility complex antigen / HLA class II histocompatibility antigen, DP beta 1 chain
protein / Immune response / Major histocompatibility complex antigen / HLA class II histocompatibility antigen, DP beta 1 chain
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx