Protein or Target Summary
Homeobox protein Nkx-3.1
| Gene ID | 4824 |
|---|---|
| uniprot | Q99801 |
| Gene Name | NKX3-1 |
| Ensernbl ID | ENSP00000370253 |
| Family | Belongs to the NK-3 homeobox family. |
| Sequence | MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW Show more |
Gene and Protein Information
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Homeobox protein Nkx-3.1
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein Nkx-3.1
protein / nucleic acid binding / DNA binding protein / Homeobox protein Nkx-3.1
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein Nkx-3.1
DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein Nkx-3.1
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein Nkx-3.1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx