NPBWR1

Description	Neuropeptides B/W receptor type 1

Gene and Protein Information

Gene ID	2831
Uniprot Accession IDs	Q6NTC7
Ensembl ID	ENSP00000330284
Symbol	GPR7 GPR7
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MDNASFSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGNSAVLYVLLRAPRMKTVTNLFILNLAIADELFTLVLPINIADFLLRQWPFGELMCKLIVAIDQYNTFSSLYFLTVMSADRYLVVLATAESRRVAGRTYSAARAVSLAVWGIVTLVVLPFAVFARLDDEQGRRQCVLVFPQPEAFWWRASRLYTLVLGFAIPVSTICVLYTTLLCRLHAMRLDSHAKALERAKKRVTFLVVAILAVCLLCWTPYHLSTVVALTTDLPQTPLVIAISYFITSLSYANSCLNPFLYAFLDASFRRNLRQLITCRAAA Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	739992	NPBWR1	neuropeptides B and W receptor 1	9598	VGNC:14637	OMA, EggNOG
Macaque	710519	NPBWR1	neuropeptides B and W receptor 1	9544		Inparanoid, EggNOG
Mouse	226304	Npbwr1	neuropeptides B/W receptor 1	10090	MGI:891989	Inparanoid, OMA, EggNOG
Rat	297795	Npbwr1	neuropeptides B and W receptor 1	10116	RGD:1305917	Inparanoid, OMA, EggNOG
Dog	486949	NPBWR1	neuropeptides B and W receptor 1	9615	VGNC:43912	Inparanoid, OMA, EggNOG
Cow	281207	NPBWR1	neuropeptides B and W receptor 1	9913	VGNC:32193	Inparanoid, OMA, EggNOG
Pig	100628123	NPBWR1	neuropeptides B and W receptor 1	9823		OMA, EggNOG
Opossum	100030316	NPBWR1	neuropeptides B and W receptor 1	13616		Inparanoid, OMA
Chicken	421117	NPBWR1	neuropeptides B/W receptor 1	9031	CGNC:11358	Inparanoid, OMA, EggNOG
Anole lizard		NPBWR1	neuropeptides B and W receptor 1 [Source:HGNC Symbol;Acc:HGNC:4522]	28377		Inparanoid, OMA
Xenopus		npbwr1	neuropeptides B/W receptor 1 [Source:Xenbase;Acc:XB-GENE-984596]	8364		OMA, EggNOG

Protein Classes

PANTHER Classes
protein / receptor / G-protein coupled receptor / Neuropeptides B/W receptor type 1

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Neuropeptide W/neuropeptide B receptor / Neuropeptides B/W receptor type 1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]