Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

Natural cytotoxicity triggering receptor 1

Gene ID9437
uniprotO76036
Gene NameNCR1
Ensernbl IDENSP00000291890
FamilyBelongs to the natural cytotoxicity receptor (NCR) family.
Sequence
MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN9437NCR1Natural cytotoxicity triggering receptor 1O76036
MOUSENcr1Natural cytotoxicity triggering receptor 1A0A0U1RP63
MOUSENcr1Uncharacterized proteinQ3T9W3
MOUSE17086Ncr1Natural cytotoxicity triggering receptor 1A0A0R4IZY7
MOUSE17086Ncr1Natural cytotoxicity triggering receptor 1Q8C567
RAT117547Ncr1Natural cytotoxicity triggering receptor 1Q9Z0H5

Protein Classes

PANTHER Classes
protein    /    receptor    /    immunoglobulin receptor superfamily    /    Natural cytotoxicity triggering receptor 1
protein    /    receptor    /    defense/immunity protein    /    Natural cytotoxicity triggering receptor 1
protein    /    receptor    /    membrane-bound signaling molecule    /    Natural cytotoxicity triggering receptor 1
protein    /    receptor    /    protease inhibitor    /    Natural cytotoxicity triggering receptor 1
protein    /    receptor    /    cytokine receptor    /    Natural cytotoxicity triggering receptor 1
DTO Classes
protein    /    Receptor    /    Cytokine receptor    /    Immunoglobulin receptor superfamily    /    Natural cytotoxicity triggering receptor 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source