Protein or Target Summary
Natural cytotoxicity triggering receptor 1
Gene ID | 9437 |
---|---|
uniprot | O76036 |
Gene Name | NCR1 |
Ensernbl ID | ENSP00000291890 |
Family | Belongs to the natural cytotoxicity receptor (NCR) family. |
Sequence | MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL Show more |
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|---|---|---|---|
HUMAN | 9437 | NCR1 | Natural cytotoxicity triggering receptor 1 | O76036 |
MOUSE | Ncr1 | Natural cytotoxicity triggering receptor 1 | A0A0U1RP63 | |
MOUSE | Ncr1 | Uncharacterized protein | Q3T9W3 | |
MOUSE | 17086 | Ncr1 | Natural cytotoxicity triggering receptor 1 | A0A0R4IZY7 |
MOUSE | 17086 | Ncr1 | Natural cytotoxicity triggering receptor 1 | Q8C567 |
RAT | 117547 | Ncr1 | Natural cytotoxicity triggering receptor 1 | Q9Z0H5 |
Protein Classes
PANTHER Classes
protein / receptor / immunoglobulin receptor superfamily / Natural cytotoxicity triggering receptor 1
protein / receptor / defense/immunity protein / Natural cytotoxicity triggering receptor 1
protein / receptor / membrane-bound signaling molecule / Natural cytotoxicity triggering receptor 1
protein / receptor / protease inhibitor / Natural cytotoxicity triggering receptor 1
protein / receptor / cytokine receptor / Natural cytotoxicity triggering receptor 1
protein / receptor / immunoglobulin receptor superfamily / Natural cytotoxicity triggering receptor 1
protein / receptor / defense/immunity protein / Natural cytotoxicity triggering receptor 1
protein / receptor / membrane-bound signaling molecule / Natural cytotoxicity triggering receptor 1
protein / receptor / protease inhibitor / Natural cytotoxicity triggering receptor 1
protein / receptor / cytokine receptor / Natural cytotoxicity triggering receptor 1
DTO Classes
protein / Receptor / Cytokine receptor / Immunoglobulin receptor superfamily / Natural cytotoxicity triggering receptor 1
protein / Receptor / Cytokine receptor / Immunoglobulin receptor superfamily / Natural cytotoxicity triggering receptor 1
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx