JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Purine nucleoside phosphorylase

Gene ID	4860
uniprot	P00491
Gene Name	PNP
Ensernbl ID	ENSP00000354532
Family	Belongs to the PNP/MTAP phosphorylase family.
Sequence	MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	4860	PNP	Purine nucleoside phosphorylase	P00491
MOUSE		Pnp	Purine nucleoside phosphorylase	A0A2I3BS22
MOUSE	18950	Pnp	Purine nucleoside phosphorylase	Q543K9
MOUSE	18950	Pnp	Purine nucleoside phosphorylase	P23492
RAT	290029	Pnp	Purine nucleoside phosphorylase	P85973

Protein Classes

PANTHER Classes
protein / transferase / phosphorylase / Purine nucleoside phosphorylase

DTO Classes
protein / Enzyme / Transferase / Phosphorylase / Purine nucleoside phosphorylase

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx