Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

PNP

DescriptionPurine nucleoside phosphorylase

Gene and Protein Information

Gene ID4860
Uniprot Accession IDs B2R8S5 D3DS00 Q15160 Q5PZ03 PNP
Ensembl ID ENSP00000354532
Symbol NP NP PUNP PRO1837
FamilyBelongs to the PNP/MTAP phosphorylase family.
Sequence
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp737850PNPpurine nucleoside phosphorylase9598VGNC:3356OMA, EggNOG
Mouse667034Pnp2purine-nucleoside phosphorylase 210090MGI:3712328Inparanoid, OMA, EggNOG
Rat290029Pnppurine nucleoside phosphorylase10116RGD:1597189Inparanoid, OMA, EggNOG
Dog475393PNPpurine nucleoside phosphorylase9615VGNC:44751OMA, EggNOG
Horse100072592LOC100072592purine nucleoside phosphorylase-like9796Inparanoid, OMA, EggNOG
Cow493724PNPpurine nucleoside phosphorylase9913OMA, EggNOG
Pig100157138PNPpurine nucleoside phosphorylase9823OMA, EggNOG
Platypus100084590PNPpurine nucleoside phosphorylase9258Inparanoid, EggNOG
Anole lizard100567275pnppurine nucleoside phosphorylase28377Inparanoid, OMA, EggNOG
Xenopus448370pnppurine nucleoside phosphorylase8364XB-GENE-1011598OMA, EggNOG
Zebrafish791647pnp5apurine nucleoside phosphorylase 5a7955ZDB-GENE-040426-2553Inparanoid, EggNOG
S.cerevisiae850906PNP1purine-nucleoside phosphorylase4932S000004199Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transferase    /    phosphorylase    /    Purine nucleoside phosphorylase
DTO Classes
protein    /    Enzyme    /    Transferase    /    Phosphorylase    /    Purine nucleoside phosphorylase

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.