The store will not work correctly when cookies are disabled.
Gene and Protein Information
Gene ID | 9241 |
Uniprot Accession IDs | Q13253 |
Ensembl ID | ENSP00000328181 |
Symbol | SYM1 SYNS1 SYNS1A |
Family | Belongs to the noggin family. |
Sequence | MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 468413 | NOG | noggin | 9598 | VGNC:9602 | OMA, EggNOG |
Macaque | 707338 | NOG | noggin | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 18121 | Nog | noggin | 10090 | MGI:104327 | Inparanoid, OMA, EggNOG |
Rat | 25495 | Nog | noggin | 10116 | RGD:3183 | Inparanoid, OMA, EggNOG |
Dog | | NOG | noggin [Source:HGNC Symbol;Acc:HGNC:7866] | 9615 | | OMA, EggNOG |
Cow | 538769 | NOG | noggin | 9913 | VGNC:32153 | Inparanoid, OMA, EggNOG |
Opossum | 100011976 | NOG | noggin | 13616 | | Inparanoid, OMA, EggNOG |
Chicken | 373912 | NOG | noggin | 9031 | CGNC:2255 | Inparanoid, OMA |
Anole lizard | 100567207 | nog | noggin | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | 493191 | nog | noggin | 8364 | XB-GENE-487724 | Inparanoid, OMA, EggNOG |
Zebrafish | 30173 | nog3 | noggin 3 | 7955 | ZDB-GENE-990714-8 | OMA, EggNOG |
Zebrafish | 30174 | nog1 | noggin 1 | 7955 | ZDB-GENE-991206-8 | Inparanoid, OMA |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|