The store will not work correctly when cookies are disabled.
NAP1L1
| Description | Nucleosome assembly protein 1-like 1 |
|---|
Gene and Protein Information
| Gene ID | 4673 |
|---|
| Uniprot Accession IDs | B3KNT8 B3KV44 |
|---|
| Ensembl ID | ENSP00000477538 |
|---|
| Symbol | NRP NRP NAP1 NAP1L |
|---|
| Family | Belongs to the nucleosome assembly protein (NAP) family. |
|---|
| Sequence | MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 452083 | NAP1L1 | nucleosome assembly protein 1 like 1 | 9598 | VGNC:8471 | OMA, EggNOG |
| Macaque | 719047 | NAP1L1 | nucleosome assembly protein 1 like 1 | 9544 | | Inparanoid, OMA |
| Macaque | 706480 | LOC706480 | nucleosome assembly protein 1-like 1 | 9544 | | OMA, EggNOG |
| Mouse | 53605 | Nap1l1 | nucleosome assembly protein 1-like 1 | 10090 | MGI:1855693 | Inparanoid, OMA, EggNOG |
| Rat | 89825 | Nap1l1 | nucleosome assembly protein 1-like 1 | 10116 | RGD:71094 | Inparanoid, OMA, EggNOG |
| Dog | 475407 | NAP1L1 | nucleosome assembly protein 1 like 1 | 9615 | | Inparanoid, OMA, EggNOG |
| Horse | 100050241 | NAP1L1 | nucleosome assembly protein 1 like 1 | 9796 | VGNC:20557 | Inparanoid, OMA, EggNOG |
| Cow | 790872 | NAP1L1 | nucleosome assembly protein 1 like 1 | 9913 | | Inparanoid, OMA, EggNOG |
| Pig | 100524086 | NAP1L1 | nucleosome assembly protein 1 like 1 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100012744 | NAP1L1 | nucleosome assembly protein 1 like 1 | 13616 | | OMA, EggNOG |
| Chicken | 417864 | NAP1L1 | nucleosome assembly protein 1 like 1 | 9031 | CGNC:50609 | Inparanoid, OMA |
| Anole lizard | 100566103 | nap1l1 | nucleosome assembly protein 1 like 1 | 28377 | | Inparanoid, OMA |
| Xenopus | 407956 | nap1l1 | nucleosome assembly protein 1 like 1 | 8364 | XB-GENE-484197 | Inparanoid, OMA |
| Zebrafish | 368260 | nap1l1 | nucleosome assembly protein 1-like 1 | 7955 | ZDB-GENE-030516-2 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
