The store will not work correctly when cookies are disabled.
KLRK1
| Description | NKG2-D type II integral membrane protein |
|---|
Gene and Protein Information
| Gene ID | 100528032 |
|---|
| Uniprot Accession IDs | A8K7K5 A8K7P4 Q9NR41 |
|---|
| Ensembl ID | ENSP00000240618 |
|---|
| Symbol | D12S2489E NKG2D |
|---|
| Sequence | MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 450153 | KLRK1 | killer cell lectin like receptor K1 | 9598 | VGNC:52050 | Inparanoid, OMA, EggNOG |
| Macaque | 574240 | NKG2D | NKG2D protein | 9544 | | Inparanoid, OMA |
| Mouse | 27007 | Klrk1 | killer cell lectin-like receptor subfamily K, member 1 | 10090 | MGI:1196250 | Inparanoid, OMA, EggNOG |
| Rat | 24934 | Klrk1 | killer cell lectin like receptor K1 | 10116 | RGD:3180 | Inparanoid, OMA |
| Dog | 611355 | KLRK1 | killer cell lectin like receptor K1 | 9615 | | Inparanoid, OMA, EggNOG |
| Horse | 100053963 | KLRK1 | killer cell lectin like receptor K1 | 9796 | VGNC:52401 | Inparanoid, OMA, EggNOG |
| Cow | 404058 | KLRK1 | killer cell lectin-like receptor subfamily K, member 1 | 9913 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
