NNMT

Description	Nicotinamide N-methyltransferase

Gene and Protein Information

Gene ID	4837
Uniprot Accession IDs	P40261
Ensembl ID	ENSP00000441434
Family	Belongs to the class I-like SAM-binding methyltransferase superfamily. NNMT/PNMT/TEMT family.
Sequence	MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	451558	NNMT	nicotinamide N-methyltransferase	9598	VGNC:3092	OMA, EggNOG
Macaque	695185	NNMT	nicotinamide N-methyltransferase	9544		Inparanoid, OMA, EggNOG
Mouse	18113	Nnmt	nicotinamide N-methyltransferase	10090	MGI:1099443	Inparanoid, OMA, EggNOG
Rat	300691	Nnmt	nicotinamide N-methyltransferase	10116	RGD:1309606	Inparanoid, OMA, EggNOG
Dog	489396	NNMT	nicotinamide N-methyltransferase	9615	VGNC:43869	Inparanoid, OMA
Opossum	100032114	NNMT	nicotinamide N-methyltransferase	13616		Inparanoid, OMA
Platypus	100080750	NNMT	nicotinamide N-methyltransferase	9258		Inparanoid, OMA
C. elegans	179385	anmt-3	Amine N-MethylTransferase	6239		Inparanoid, OMA

PANTHER Classes
protein / transferase / methyltransferase / Nicotinamide N-methyltransferase

DTO Classes
protein / Enzyme / Transferase / Methyltransferase / Nicotinamide N-methyltransferase

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source