The store will not work correctly when cookies are disabled.
NNMT
| Description | Nicotinamide N-methyltransferase |
|---|
Gene and Protein Information
| Gene ID | 4837 |
|---|
| Uniprot Accession IDs | P40261 |
|---|
| Ensembl ID | ENSP00000441434 |
|---|
| Family | Belongs to the class I-like SAM-binding methyltransferase superfamily. NNMT/PNMT/TEMT family. |
|---|
| Sequence | MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 451558 | NNMT | nicotinamide N-methyltransferase | 9598 | VGNC:3092 | OMA, EggNOG |
| Macaque | 695185 | NNMT | nicotinamide N-methyltransferase | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 18113 | Nnmt | nicotinamide N-methyltransferase | 10090 | MGI:1099443 | Inparanoid, OMA, EggNOG |
| Rat | 300691 | Nnmt | nicotinamide N-methyltransferase | 10116 | RGD:1309606 | Inparanoid, OMA, EggNOG |
| Dog | 489396 | NNMT | nicotinamide N-methyltransferase | 9615 | VGNC:43869 | Inparanoid, OMA |
| Opossum | 100032114 | NNMT | nicotinamide N-methyltransferase | 13616 | | Inparanoid, OMA |
| Platypus | 100080750 | NNMT | nicotinamide N-methyltransferase | 9258 | | Inparanoid, OMA |
| C. elegans | 179385 | anmt-3 | Amine N-MethylTransferase | 6239 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
