The store will not work correctly when cookies are disabled.
NNMT
| Description | Nicotinamide N-methyltransferase |
|---|
Gene and Protein Information
| Gene ID | 4837 |
|---|
| Uniprot Accession IDs | P40261 |
|---|
| Ensembl ID | ENSP00000441434 |
|---|
| Family | Belongs to the class I-like SAM-binding methyltransferase superfamily. NNMT/PNMT/TEMT family. |
|---|
| Sequence | MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL |
|---|
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 4837 | NNMT | Nicotinamide N-methyltransferase | P40261 |
| MOUSE | 18113 | Nnmt | Nicotinamide N-methyltransferase | D3YX59 |
| MOUSE | 18113 | Nnmt | Uncharacterized protein | Q9D9X3 |
| MOUSE | 18113 | Nnmt | Nicotinamide N-methyltransferase | O55239 |
| RAT | 300691 | Nnmt | Nicotinamide N-methyltransferase | D4A605 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
