The store will not work correctly when cookies are disabled.
Protein or Target Summary
N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D
Gene ID | 222236 |
uniprot | Q6IQ20 |
Gene Name | NAPEPLD |
Ensernbl ID | ENSP00000407112 |
Family | Belongs to the NAPE-PLD family. |
Sequence | MDENESNQSLMTSSQYPKEAVRKRQNSARNSGASDSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWPTWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMDELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSVIALNERFGNELRWFVPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLMDDNKVLWGSWSVLGPWNRFFFAGDTGYCPAFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDENF Show more |
---|
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|
HUMAN | 222236 | NAPEPLD | N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D | Q6IQ20 |
MOUSE | | Napepld | Uncharacterized protein | Q8BLU8 |
MOUSE | 242864 | Napepld | N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D | Q8BH82 |
RAT | | Napepld | N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D | A0A0G2K5Y7 |
RAT | 296757 | Napepld | N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D | Q769K2 |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|