JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Beta-nerve growth factor

Gene ID	4803
uniprot	P01138
Gene Name	NGF
Ensernbl ID	ENSP00000358525
Family	Belongs to the NGF-beta family.
Sequence	MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	4803	NGF	Beta-nerve growth factor	P01138
MOUSE		Ngf	Beta-nerve growth factor	A0A0G2JG51
MOUSE		Ngf	Beta-nerve growth factor	A0A0G2JEK0
MOUSE	18049	Ngf	Beta-nerve growth factor	Q6LDU8
MOUSE	18049	Ngf	Beta-nerve growth factor	P01139
RAT		Ngf	Beta-nerve growth factor	A0A0G2K2Z7
RAT	310738	Ngf	Beta-nerve growth factor	P25427

Protein Classes

PANTHER Classes
protein / growth factor / neurotrophic factor / Beta-nerve growth factor

DTO Classes
protein / Signaling / Growth factor / Neurotrophic factor / Beta-nerve growth factor

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx