The store will not work correctly when cookies are disabled.
NGF
| Description | Beta-nerve growth factor |
|---|
Gene and Protein Information
| Gene ID | 4803 |
|---|
| Uniprot Accession IDs | A1A4E5 Q6FHA0 Q96P60 Q9P2Q8 Q9UKL8 Beta-NGF |
|---|
| Ensembl ID | ENSP00000358525 |
|---|
| Symbol | NGFB NGFB HSAN5 Beta-NGF |
|---|
| Family | Belongs to the NGF-beta family. |
|---|
| Sequence | MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 469423 | NGF | nerve growth factor | 9598 | VGNC:8424 | Inparanoid, OMA |
| Mouse | 18049 | Ngf | nerve growth factor | 10090 | MGI:97321 | Inparanoid, OMA, EggNOG |
| Rat | 310738 | Ngf | nerve growth factor | 10116 | RGD:1598328 | Inparanoid, OMA, EggNOG |
| Dog | 403402 | NGF | nerve growth factor | 9615 | VGNC:54333 | Inparanoid, OMA, EggNOG |
| Horse | 100065669 | NGF | nerve growth factor | 9796 | VGNC:20727 | Inparanoid, OMA, EggNOG |
| Cow | 281350 | NGF | nerve growth factor | 9913 | VGNC:32061 | Inparanoid, OMA, EggNOG |
| Opossum | | NGF | nerve growth factor [Source:HGNC Symbol;Acc:HGNC:7808] | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 396466 | NGF | nerve growth factor | 9031 | CGNC:1838 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100553574 | ngf | nerve growth factor | 28377 | | OMA, EggNOG |
| Xenopus | 100170161 | ngf | nerve growth factor | 8364 | XB-GENE-1013200 | Inparanoid, OMA, EggNOG |
| Zebrafish | 58133 | ngfb | nerve growth factor b (beta polypeptide) | 7955 | ZDB-GENE-000629-2 | OMA, EggNOG |
| Zebrafish | 30270 | ngfa | nerve growth factor a (beta polypeptide) | 7955 | ZDB-GENE-990415-176 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
