Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

NGF

DescriptionBeta-nerve growth factor

Gene and Protein Information

Gene ID4803
Uniprot Accession IDs P01138 A1A4E5 Q6FHA0 Q96P60 Q9P2Q8 Q9UKL8 Beta-NGF
Ensembl ID ENSP00000358525
Symbol NGFB NGFB HSAN5 Beta-NGF
FamilyBelongs to the NGF-beta family.
Sequence
MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp469423NGFnerve growth factor9598VGNC:8424Inparanoid, OMA
Mouse18049Ngfnerve growth factor10090MGI:97321Inparanoid, OMA, EggNOG
Rat310738Ngfnerve growth factor10116RGD:1598328Inparanoid, OMA, EggNOG
Dog403402NGFnerve growth factor9615VGNC:54333Inparanoid, OMA, EggNOG
Horse100065669NGFnerve growth factor9796VGNC:20727Inparanoid, OMA, EggNOG
Cow281350NGFnerve growth factor9913VGNC:32061Inparanoid, OMA, EggNOG
OpossumNGFnerve growth factor [Source:HGNC Symbol;Acc:HGNC:7808]13616Inparanoid, OMA, EggNOG
Chicken396466NGFnerve growth factor9031CGNC:1838Inparanoid, OMA, EggNOG
Anole lizard100553574ngfnerve growth factor28377OMA, EggNOG
Xenopus100170161ngfnerve growth factor8364XB-GENE-1013200Inparanoid, OMA, EggNOG
Zebrafish58133ngfbnerve growth factor b (beta polypeptide)7955ZDB-GENE-000629-2OMA, EggNOG
Zebrafish30270ngfanerve growth factor a (beta polypeptide)7955ZDB-GENE-990415-176Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    growth factor    /    neurotrophic factor    /    Beta-nerve growth factor
DTO Classes
protein    /    Signaling    /    Growth factor    /    Neurotrophic factor    /    Beta-nerve growth factor

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

The page will load shortly, Thanks for your patience!
NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      1.Lallena, M J MJ, Diaz-Meco, M T MT, Bren, G G, Payá, C V CV and Moscat, J J. 1999-03 Activation of IkappaB kinase beta by protein kinase C isoforms. [PMID:10022904]
      2.Tong, Y Y, Wang, H H and Chen, W W. 1997-11 [Cloning and sequencing of the gene for premature beta nerve growth factor]. [PMID:10322959]
      3.Billon, N N and 6 more authors. 1999-05-06 Cooperation of Sp1 and p300 in the induction of the CDK inhibitor p21WAF1/CIP1 during NGF-mediated neuronal differentiation. [PMID:10362258]
      4.Cargill, M M and 17 more authors. 1999-07 Characterization of single-nucleotide polymorphisms in coding regions of human genes. [PMID:10391209]
      5.Wiesmann, C C, Ultsch, M H MH, Bass, S H SH and de Vos, A M AM. 1999-09-09 Crystal structure of nerve growth factor in complex with the ligand-binding domain of the TrkA receptor. [PMID:10490030]
      6.Ong, S H SH and 6 more authors. 2000-02 FRS2 proteins recruit intracellular signaling pathways by binding to diverse targets on fibroblast growth factor and nerve growth factor receptors. [PMID:10629055]
      7.Gonias, S L SL and 5 more authors. 2000-02-25 Identical or overlapping sequences in the primary structure of human alpha(2)-macroglobulin are responsible for the binding of nerve growth factor-beta, platelet-derived growth factor-BB, and transforming growth factor-beta. [PMID:10681572]
      8.Reuther, G W GW and Der, C J CJ. 2000-04 The Ras branch of small GTPases: Ras family members don't fall far from the tree. [PMID:10712923]
      9.Mukai, J J and 10 more authors. 2000-06-09 NADE, a p75NTR-associated cell death executor, is involved in signal transduction mediated by the common neurotrophin receptor p75NTR. [PMID:10764727]
      10.Sanico, A M AM and 7 more authors. 2000-05 Nerve growth factor expression and release in allergic inflammatory disease of the upper airways. [PMID:10806167]