JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
NCR3

NCR3

Description	Natural cytotoxicity triggering receptor 3

Gene and Protein Information

Gene ID	259197
Uniprot Accession IDs	B0S8F2 B0S8F4 B0S8F5 O14930 O14932 O95667 O95668 O95669 Q5ST89 Q5ST90 Q5ST91 Q5ST92 Q5STA3
Ensembl ID	ENSP00000342156
Symbol	1C7 LY117 1C7 MALS CD337 LY117 NKp30
Family	Belongs to the natural cytotoxicity receptor (NCR) family.
Sequence	MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	449613	NCR3	natural cytotoxicity triggering receptor 3	9598	VGNC:11131	Inparanoid, OMA, EggNOG
Macaque	715574	NCR3	natural cytotoxicity triggering receptor 3	9544		Inparanoid, OMA
Rat	294251	Ncr3	natural cytotoxicity triggering receptor 3	10116	RGD:727881	Inparanoid, OMA, EggNOG
Dog	607220	NCR3	natural cytotoxicity triggering receptor 3	9615	VGNC:43666	Inparanoid, OMA, EggNOG
Horse	100058447	NCR3	natural cytotoxicity triggering receptor 3	9796	VGNC:20604	Inparanoid, OMA, EggNOG
Cow	513769	NCR3	natural cytotoxicity triggering receptor 3	9913	VGNC:31927	Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]