The store will not work correctly when cookies are disabled.
NCR3
| Description | Natural cytotoxicity triggering receptor 3 |
|---|
Gene and Protein Information
| Gene ID | 259197 |
|---|
| Uniprot Accession IDs | B0S8F2 B0S8F4 B0S8F5 O14930 O14932 O95667 O95668 O95669 Q5ST89 Q5ST90 Q5ST91 Q5ST92 Q5STA3 |
|---|
| Ensembl ID | ENSP00000342156 |
|---|
| Symbol | 1C7 LY117 1C7 MALS CD337 LY117 NKp30 |
|---|
| Family | Belongs to the natural cytotoxicity receptor (NCR) family. |
|---|
| Sequence | MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 449613 | NCR3 | natural cytotoxicity triggering receptor 3 | 9598 | VGNC:11131 | Inparanoid, OMA, EggNOG |
| Macaque | 715574 | NCR3 | natural cytotoxicity triggering receptor 3 | 9544 | | Inparanoid, OMA |
| Rat | 294251 | Ncr3 | natural cytotoxicity triggering receptor 3 | 10116 | RGD:727881 | Inparanoid, OMA, EggNOG |
| Dog | 607220 | NCR3 | natural cytotoxicity triggering receptor 3 | 9615 | VGNC:43666 | Inparanoid, OMA, EggNOG |
| Horse | 100058447 | NCR3 | natural cytotoxicity triggering receptor 3 | 9796 | VGNC:20604 | Inparanoid, OMA, EggNOG |
| Cow | 513769 | NCR3 | natural cytotoxicity triggering receptor 3 | 9913 | VGNC:31927 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
